Conserved Protein Domain Family
PRK13854

?
PRK13854: PRK13854 
type IV secretion system protein VirB3; Provisional
Statistics
?
PSSM-Id: 139914
View PSSM: PRK13854
Aligned: 10 rows
Threshold Bit Score: 145.352
Threshold Setting Gi: 148244026
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 16119784    1 MNDRLEEATLYLAATRPALFLGVPLTLAGLLVMFAGFVIVIVQNPLYEVVLVPLWFGARLVVERDYNAASVVLLFLQTAG 80
gi 10955145    1 MNDRLEEATLYLAATRPALFLGVPLTLAGLFMMFAGFVIVIVQNPLYEVVLAPLWFGARLIVERDYNAASVVLLFLRTAG 80
gi 10954963    1 MNDRLEEATLYLAATRPALFLGVPLTLAGLLVMFAGFVIVIVQNPLYEVVLVPLWFGARLVVERDYNAASVVLLFLQTAG 80
gi 10954801    1 MNADLEEATLYLAATRPALFFGVPLTLAGVFMMLAGFLIVVVQNPLYEIVLLPLWLGARLIVERDYNAASVVLLFLQTAG 80
gi 86359749    1 MNERLEEATLYLAATRPALFLGVPLTLAGIFMMLGGFVIVVVQNPLYEVVIIPLWFSARLVVERDYNAASVVLLFLQTAG 80
gi 190014769   1 MADRLEESTLYLAATRPALFLGVPLTLAGLFMMFAGFVIVIVQNPLYEVVLVPLWFAARLIVERDYNAASVVLLFLRTAG 80
gi 190404467   1 MNADLEEATLYLAATRPALFFGVPLTLAGVFMMLAGFLIVVVQNPLYEIVLLPLWLGARLIVERDYNAASVVLLFLQTAG 80
gi 148244026   1 MTER-QRDPLFVAATRPALFLGLPIEMAVVIIMIAAMIVIFGHNPFYLTLVLPLWFGARCLVRYDYNAPRVAWLWFRTKA 79
gi 150378124   1 MSDRLEESTLYVAATRPALFLGVPLNLAALLMMLAGLIIVVVQNPLYEIILVPLWFGSRVVVERDYNAASVALLYLRTAG 80
gi 222080246   1 MIKDLEEATLYLAATRPALFFGVPLTLAGVFMMLAGFLIVIVQNPLYEIVLLPLWLGARLVVERDYNAASVVLLFLQTAG 80
                         90       100
                 ....*....|....*....|....*....
gi 16119784   81 RSV-DGLIWGGASVSPNPIKVPARGRGMA 108
gi 10955145   81 RSI-DSAVWGGATVSPNPIRVPPRGRGMV 108
gi 10954963   81 RSV-DGLIWGGASVSPNPIKVPARGRGMA 108
gi 10954801   81 RSV-DGHAWGGASVSPNPIRVASRGRGMT 108
gi 86359749   81 RNV-DGLVWGGASVSPNPIRVPARGRGMA 108
gi 190014769  81 RSI-DSAVWGGATVSPNPIRVPPRGRGMV 108
gi 190404467  81 RSV-DGHAWGGASVSPNPIRVASRGRGMT 108
gi 148244026  80 TGAgENQAWGGASPAPFPMKV-QQGRGMR 107
gi 150378124  81 RSV-DAPFWGGASVSPNPIKVPRRGRGML 108
gi 222080246  81 RSV-DGHTWGGASVSPNPIRVASRGRGMT 108
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap