Conserved Protein Domain Family
PRK13869

?
PRK13869: PRK13869 
plasmid-partitioning protein RepA; Provisional
Statistics
?
PSSM-Id: 139929
View PSSM: PRK13869
Aligned: 6 rows
Threshold Bit Score: 831.243
Threshold Setting Gi: 190014726
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190014726   1 MSKAAAILRNDRPSAEVTIGGHAEQLSSQLHAMSEALFPPASHKSLRKFTSGEAARLMKISDSTLRKMTLAGEGPQPELA 80
gi 159161958   1 MSKAAAISRNDRPSVDVTIGEHAEQLSSQLQAMSEALFPPTSHKSLRKFTSGEAARLMKISDSTLRKMTLAGEGPQPELA 80
gi 86359878    1 MSVATNPNRKALPSVDETIGEQADLLSSQLQSMSEALFPPSSQKILRKFTSGEAARLMGVSDSTLRKMTLAGEGPQPETT 80
gi 10955106    1 MSKAAAISRNDRPSVDVTIGEHAEQLSSQLQAMSEALFPPTSHKTLRKFTSGEAARLMKISDSTLRKMTLAGEGPQPELA 80
gi 10954839    1 MSKAAAISRNDRPSVDVTIGEHAEQLSSQLQAMSEALFPPTSHKSLRKFTSGEAARLMKISDSTLRKMTLAGEGPQPELA 80
gi 222109068   7 VSKAAAISRNDRPSVDVTIGEHAEQLSSQLQAMSEALFPPTSHKSLRKFTSGEAARLMKISDSTLRKMTLAGEGPQPELA 86
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190014726  81 SNGRRFYTLSQINEIRGMLAGSTRGRESIDFVPHRRGSEHLQVIAVTNFKGGSGKTTTSAHLSQYLALQGYRVLTVDLDP 160
gi 159161958  81 SNGRRFYTLGQINEIRQMLAGSTRGRESIDFVPHRRGSEHLQVVAVTNFKGGSGKTTTSAHLAQYLALQGYRVLAVDLDP 160
gi 86359878   81 SNGRRLYTLSDINQIRRLLAQSTRGRESIEFVPHRRPGEHLQVLAVTNFKGGSGKTTTSAHLAQYLALQGYRVLAVDLDP 160
gi 10955106   81 SNGRRFYTLGQINEIRGMLARSTRGRESIEFVPHRRGSEHLQVIAVTNFKGGSGKTTTSAHLAQYLALQGYRVLAVDLDP 160
gi 10954839   81 SNGRRFYTLGQINEIRQMLAGSTRGRESIDFVPHRRGSEHLQVVAVTNFKGGSGKTTTSAHLAQYLALQGYRVLAVDLDP 160
gi 222109068  87 SNGRRFYTLGQINEIRQMLAGSTRGRESIDFVPHRRGSEHLQVIAVTNFKGGSGKTTTSAHLAQYLALQGYRVLAVDLDP 166
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190014726 161 QASLSALLGVLPESDIRANETLYAAIRYDETRRPLRDVIRPTYFDGLHLVPGNLELMEFEHATPKALSDRGTRDGLFFTR 240
gi 159161958 161 QASLSALLGVLPETDVGANETLYAAIRYDDTRRPLRDVIRPTYFDGLHLVPGNLELMEFEHTTPKALTDKGTRDGLFFTR 240
gi 86359878  161 QASLSALLGVLPELDVASNQTLYAAIRYDSERRNLSEVIRSTYFDGLDLVPGNLELMEFEHTTPKALSAGAVGETLFFAR 240
gi 10955106  161 QASLSALLGVLPETDVGANETLYAAIRYDDTRRPLRDVIRPTYFDGLHLVPGNLELMEFEHTTPKALSDRGGRDGLFFTR 240
gi 10954839  161 QASLSALLGVLPETDVGANETLYAAIRYDDTRRPLRDVIRPTYFDGLHLVPGNLELMEFEHTTPKALTDKGTRDGLFFTR 240
gi 222109068 167 QASLSALLGVLPETDVGANETLYAAIRYDETRRPLRDVIRPTYFDGLHLVPGNLELMEFEHTTPKALTDKGTRDGLFFTR 246
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190014726 241 VAQAFDDVADDYDVVVIDCPPQLGFLTLSGLCAATSMVITVHPQMLDIASMSQFLLMTRDLLGVVKEAGGNLQYDFIRYL 320
gi 159161958 241 VAQAFDEVADDYDVVVIDCPPQLGFLTLSGLCAATSMVITVHPQMLDIASMSQFLLMTRDLLGVVKEAGGNLQYDFIRYL 320
gi 86359878  241 VAAAIDEVADNYDVVVIDCPPQLGFLTLSGLCAATAMIVTVHPQMLDISSMSQFLLMTRDLLGVVRDAGGDLKYDFIRYL 320
gi 10955106  241 VAQAFDEVGDDYDVVVIDCPPQLGFLTLSGLCAATAMVVTVHPQMLDIASMSQFLLMTRDLLGVVREAGGNLQYDFIRYL 320
gi 10954839  241 VAQAFDEVADDYDVVVIDCPPQLGFLTLSGLCAATSMVITVHPQMLDIASMSQFLLMTRDLLGVVKEAGGNLQYDFIRYL 320
gi 222109068 247 VAQAFDEVADDYDVVVIDCPPQLGFLTLSGLCAATSMVITVHPQMLDIASMSQFLLMTRDLLGVVKEAGGNLQYDFIRYL 326
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 190014726 321 LTRYEPQNAPQTKVTALLRNMFEDHVLTNPMVKSAAVSDAGLTKQTLYEIGRKNLTRSTYDRAMESLDAVNSEIEALIKM 400
gi 159161958 321 LTRYEPQDAPQTKVTALLRNMFEDHVLTNPMVKSAAVSDAGLTKQTLYEIGRENLTRSTYDRAMESLDAVNSEIEALIKM 400
gi 86359878  321 LTRFEPQDAPQTKVAALLRNLFDDHVLTNPMVKSAAVSDAGLTKQTLYEIGRENLTRSTYDRAMEALDAVNSEVETLIKQ 400
gi 10955106  321 LTRYEPQDAPQTKVAALLRNMFEDHVLTNPMVKSAAVSDAGLTKQTLYEIGRENLTRSTYDRAMESLDAVNAEIEALIKA 400
gi 10954839  321 LTRYEPQDAPQTKVTALLRNMFEDHVLTNPMVKSAAVSDAGLTKQTLYEIGRENLTRSTYDRAMESLDAVNSEIEALIKM 400
gi 222109068 327 LTRYEPQDAPQTKVAALLRNMFEDHVLTNPMVKSAAVSDAGLTKQTLYEIGRENLTRSTYDRAMESLDAVNSEIEALIKT 406

                 ....*
gi 190014726 401 AWGRV 405
gi 159161958 401 AWGRV 405
gi 86359878  401 AWGRA 405
gi 10955106  401 AWGRA 405
gi 10954839  401 AWGRV 405
gi 222109068 407 AWGRA 411
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap