Conserved Protein Domain Family
rnhA

?
PRK13907: rnhA 
ribonuclease H; Provisional
Statistics
?
PSSM-Id: 139967
View PSSM: PRK13907
Aligned: 20 rows
Threshold Bit Score: 272.695
Threshold Setting Gi: 152975120
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 49477289    1 MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSLPLGTMSNHEAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKE 80
gi 42780788    1 MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSFPLGTMSNHEAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKE 80
gi 30019744    1 MIEVYIDGASKGNPGPSGAGVFIKGVQPPVQLSVPLGTMSNHEAEYRALLLALKYCIEHNYSTVSFRTDSQLVERAVEKE 80
gi 163939500   1 MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSLPLGTMSNHEAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKE 80
gi 218233881   1 MIEVYIDGASKGNPGPSGAGVFIKGVQPPVQLSVPLGTMSNHEAEYRALLLALKYCIEHNYSTVSFRTDSQLVERAVEKE 80
gi 218896627   1 MIEVYIDGASKGNPGPSGAGVFIKGVQPPVQLSLPLGTMSNHEAEYRALLLALKYCIEHNYSTVSFRTDSQLVERAVEKE 80
gi 227815554   1 MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSLPLGTMSNHEAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKE 80
gi 225863552   1 MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSLPLGTMSNHEAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKE 80
gi 229601488   1 MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSLPLGTMSNHEAEYHALLAALKYCTEHNYNIVSFRTDSQLVERAVEKE 80
gi 301053232   1 MIEVYIDGASKGNPGPSGAGVFIKGVQPAVQLSLPLGTMSNHEAEYHALLTALKYCTEHNYNIVSFRTDSQLVERAVEKE 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*...
gi 49477289   81 YAKNKMFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN 128
gi 42780788   81 YAKNKMFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN 128
gi 30019744   81 YAKNKIFAPLLDEALQYIKNFDLFFIKWIPSSQNKVADELARKAILQN 128
gi 163939500  81 YAKNKIFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN 128
gi 218233881  81 YAKNKIFAPLLDEALQYIKNFDLFFIKWIPSSQNKVADELARKAILQN 128
gi 218896627  81 YAKNKIFAPLLDEALQYIKNFDLFFIKWIPSSQNKVADELARKAILQN 128
gi 227815554  81 YAKNKMFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN 128
gi 225863552  81 YAKNKMFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN 128
gi 229601488  81 YAKNKMFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN 128
gi 301053232  81 YAKNKMFAPLLEEALQYIKSFDLFFIKWIPSSQNKVADELARKAILQN 128
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap