Conserved Protein Domain Family
PRK13916

?
PRK13916: PRK13916 
plasmid segregation protein ParR; Provisional
Links
?
Statistics
?
PSSM-Id: 139976
View PSSM: PRK13916
Aligned: 6 rows
Threshold Bit Score: 43.2453
Threshold Setting Gi: 87159869
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 58616179    8 PQKDSLRLTLYLNRKKHSELFEFLVALPDGTMPTFVRDVLEKYIQSGGFSSPLPQQNRTregDALLPSTTPIRVAQSKAH 87
gi 87159869    1 MDKKETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEIGENPPIPSKEHT---APLKEHTEPIKRNKESFK 77
gi 32470397    1 MDKKETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEIGENPPIPSKEHT---APLKEHTEPIKRNKESFK 77
gi 33416290    1 MDKKETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEIGENPPIPSKEHT---APLKEHTEPIKRNKESFK 77
gi 226464401   1 MDKKETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEIGENPPIPSKEHT---APLKEHTEPIKRNKESFK 77
gi 281427766   1 MDKKETKHLLKIKKEDYPQIFDFLENVPRGTKTAHIREALRRYIEEIGENPPIPSKEHT---APLKEHTEPIKRNKESFK 77
                         90       100
                 ....*....|....*....|
gi 58616179   88 AIELPPDADPGKLYPKHWSS 107
gi 87159869   78 DAMERKDQLKQAEMPKIEEK 97
gi 32470397   78 DAMERKDQLKQAEMPKIEEK 97
gi 33416290   78 DAMERKDQLKQAEMPKIEEK 97
gi 226464401  78 DAMERKDQLKQAEMPKIEEK 97
gi 281427766  78 DAMERKDQLKQAEMPKIEEK 97
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap