Conserved Protein Domain Family
PRK13944

?
PRK13944: PRK13944 
protein-L-isoaspartate O-methyltransferase; Provisional
Statistics
?
PSSM-Id: 140001
View PSSM: PRK13944
Aligned: 6 rows
Threshold Bit Score: 338.326
Threshold Setting Gi: 159042097
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 171186428   1 MAHRLVEELVREGVIKSESVRRAMLAVPREEFVMPEYRMMAYEDRPLPLFADATISAPHMVAMMCELVEPKPGMKILEVG 80
gi 159042097   9 ARRRLVDDLKADGIIVSREVEEAMLSVPRHLFVPNYIRHYAYQDTPLTIMRGQTISAPHMVAIMCELIKPRRGMRILEVG 88
gi 18312114    1 MAKRLVEELERDGIVKSERVKRALLTVPREEFVLPEYRMMAYEDRPLPLFAGATISAPHMVAMMCELIEPRPGMKILEVG 80
gi 126460721   1 MAARLVAELVKEGVIKSERVKNAMLKVPREEFVTPEYRMMAYEDRPLPLFAGATISAPHMVAMMCELIEPRPGMKILEVG 80
gi 145592542   1 MAKKLVDDLEREGVLKSERVKKALLSVPREEFVMPEYRMMAYEDRPLPLFADATISAPHMVAMMCELIEPRPGMSILEVG 80
gi 119872194   1 MALRLVEELTNEGIIKTERVKKAMLAVPREEFVMPEYRMMAYEDRPLPLFFDATISAPHMVAMMCELVEPRPGMKILEVG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 171186428  81 AGSGYQAAVCAEAMErRGRVYTVEIVKELAIYAAQNIERLGYWGVVEVYHGDGRSGLERHAPFDAIIVTAAARQIPPALV 160
gi 159042097  89 AGTGYQACVCARAIG-DGVVYSVEIDPYIALYATVNIIHAGFSGMVKVYQGDGKLGLPKHAPFDAVLVTAAASTVPQPLL 167
gi 18312114   81 TGSGYHAAVCAEAIEkKGRIYTIEIVKELAVFAAQNLERLGYWGVVEVYHGDGKKGLEKHAPFDAIIVTAAADVIPPALI 160
gi 126460721  81 TGSGYHAAVCAEAIErQGKVYTVEIVRELAIFAAQNLERLGYLGVVEVYRGDGRRGLERHAPFDAVLVTAAASEIPKALV 160
gi 145592542  81 TGSGYHAAVCAEAIErRGKVYTVEIVKGLAIYAAQNLERLGYWGVVEVFHSDGKRGLEKFAPYDAIIVTAAAASIPSALV 160
gi 119872194  81 TGSGYQAAVCAEAIErKGKVYTIEIVKELAIYAAQNIERLGYWGIVEVYHGDGKKGLERHAPFDAIIVTAAARTIPSELI 160
                        170       180       190       200
                 ....*....|....*....|....*....|....*....|....*
gi 171186428 161 RQLKEGGTLVIPLVEHMGQILYKVTKRGERVEKRAVTYVLFVPLR 205
gi 159042097 168 DQLTMGGVLVIPLKEDGYQKLYVIEKGKEGFRKRFITYVSFVDLR 212
gi 18312114  161 RQLKDGGVMVIPVEERLGQVLYKVVKRGDKIEKKAITYVMFVPLR 205
gi 126460721 161 EQLREGGVMVIPVEEGVGQVLYKVVKSGGKVKRQAVTYVLFVPLR 205
gi 145592542 161 NQLKDGGIMVIPVEEGFGQVLYKVVRRGEKTEKKAVTYVLFVPLR 205
gi 119872194 161 KQLKDGGVLVIPIEEGVGQVLYKITKRGEKIEKRAITYVLFVPLR 205
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap