Conserved Protein Domain Family
PRK13949

?
PRK13949: PRK13949 
shikimate kinase; Provisional
Statistics
?
PSSM-Id: 140006
View PSSM: PRK13949
Aligned: 8 rows
Threshold Bit Score: 285.855
Threshold Setting Gi: 34541244
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 212550556   1 MRRIFLIGYMGAGKTTIGKILAEKLNLSFIDTDFFIKNRYKKEITDIFAGEGEEKFRRIEQKILQEiIQKWENIVISTGG 80
gi 53711526    1 MIRIFLTGYMGAGKTTLGKALARELHIPFIDLDWYIEERFHKTVGELFSERGEASFRELEKNMLHE-VGEFEDVVISTGG 79
gi 60679787    1 MIRIFLTGYMGAGKTTLGKALARELHIPFIDLDWYIEERFHKTVGELFSERGEASFRELEKNMLHE-VGEFEDVVISTGG 79
gi 29348802    1 MVRIFLTGYMGAGKTTLGKAFARKLNVPFIDLDWYIEERFHKTVGELFTERGEAGFRELERNMLHE-VAEFENVVISTGG 79
gi 34541244    2 HAPIFIVGYMGSGKSTVGRKMADVLGWRFIDTDFFIENRFRKRVADIFRDEGEAVFRRRERVVIEE-LSGMEDAIIATGG 80
gi 150009401   1 MKRVFLVGYMGAGKTTVGKELAKLAGLSFIDLDYYIEGRYHKAVSQIFAERGEEAFREIERNMLHE-VAEFEDVLISTGG 79
gi 150003903   1 MTRIFLIGYMGAGKTTLGKAFAREMSLNFIDLDWFIEERFHKTVQQLFLERGEDGFRELERKMLHE-VAEFEDVVVSTGG 79
gi 188994384   2 HAPIFIVGYMGSGKSTVGRKMADVLGWRFIDTDFFIENRFRKRVADIFRDEGEAVFRRRERVVIEE-LSGMEDAIIATGG 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 212550556  81 GTPCFFHNMELMNASGTTVYLKATIELLTERLINMKCARPLIKDKSPEEIKYFVINNLVKRELFYNQASIVFFIKKMTMN 160
gi 53711526   80 GAPCFFDNMEYMNRVGTTVFLDVDPKVLFSRLRVAKQQRPILQGKKDDELLDFIVQALEKRAPFYRQANYIYCADKLEDR 159
gi 60679787   80 GAPCFFDNMEYMNRVGTTVFLDVDPKVLFSRLRVAKQQRPILQGKKDDELLDFIVQALEKRAPFYRQANYIYCADKLEDR 159
gi 29348802   80 GAPCFYDNMEFMNRTGKTVFLNVHPDVLFRRLRIAKQQRPILQGKEDDELMDFIIQALEKRAPFYTQAQYIFNADELEDR 159
gi 34541244   81 GLPCHSDNMTLMNEAGLTLYLEVSDEVLAVRLELCKRTRPKVKDKTGEELLSHIREEMAFRGDIYRRAKVIVNSDKLVDE 160
gi 150009401  80 GAPCFFDNMEFMNASGTTVYLKVSVEELAKRLELCKHTRPVLKGRSGEELRAFIAESLEKRNPFYTKASITFDAEKMLTE 159
gi 150003903  80 GTPCFFDNMEYMNDCGDTVFLDVEPAVLFRRLRVAKQQRPLLANKSDEELMDFICEALQKRHPFYSKAKHLFKADELEDK 159
gi 188994384  81 GLPCHSDNMTLMNEAGLTLYLEVSDEVLAVRLELCKRTRPKVKDKTGEELLSHIREEMAFRGDIYRRAKVIVNSDKLVDE 160
                        170
                 ....*....|
gi 212550556 161 DIIENLMPKI 170
gi 53711526  160 SQIETSVQQL 169
gi 60679787  160 SQIETSVQQL 169
gi 29348802  160 WQIESSVQRL 169
gi 34541244  161 EDERQLVTRI 170
gi 150009401 160 SDVHDISNAL 169
gi 150003903 160 RQIQASVDSL 169
gi 188994384 161 EDERQLVTRI 170
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap