Conserved Protein Domain Family
PRK13957

?
PRK13957: PRK13957 
indole-3-glycerol-phosphate synthase; Provisional
Statistics
?
PSSM-Id: 140013
View PSSM: PRK13957
Aligned: 6 rows
Threshold Bit Score: 443.17
Threshold Setting Gi: 189910702
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910702   1 MNPILHKIVETKHSEIE-LSRGKTLPDRKIPIRDwksNLKTNSVSVIAECKKGSPSAGILRPDYHPVEIAKLYETSGAGA 79
gi 183220594   1 MNPILHKIVETKHSEIE-LSRGKTLPDRKIPIRDwksNLKTNSVSVIAECKKGSPSAGILRPDYHPVEIAKLYETSGAGA 79
gi 45658617    6 PHRVLREIISTKQNEIKkISAWDPLPHRGLSLRD---SLKSRTFSIIAECKRKSPSAGELRADYRPVQIAKTYEELGASA 82
gi 24213540    6 PHRVLREIISTKQNEIKkISAWDPLPHRGLSLRD---SLKSRTFSIIAECKRKSPSAGELRADYRPVQIAKTYEELGASA 82
gi 116328897   6 LHRVLREIIATKQNEIEkIRNWDPVPYQGLGLRE---SLKSRSFSIIAECKRKSPSAGEICADYDPVQIAKTYEALGASA 82
gi 116330496   6 LHRVLREIIATKQNEIEkIRNWDPVPYQGLGLRE---SLKSRSFSIIAECKRKSPSAGEICADYDPVQIAKTYEALGASA 82
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910702  80 ISVLTDQSYFFGSLNDLESVANQVSLPVIRKDFILDPIQIDEAYAYGASAILLIVRILSPSLLKSLHEHANRLGLAVLVE 159
gi 183220594  80 ISVLTDQSYFFGSLNDLESVANQVSLPVIRKDFILDPIQIDEAYAYGASAILLIVRILSPSLLKSLHEHANRLGLAVLVE 159
gi 45658617   83 ISVLTDQNYFGGSLEDLKDVSSELKIPVLRKDFILDEIQIREARAFGASAILLIVRILTPEQIKSFLKLASSLGMDCLVE 162
gi 24213540   83 ISVLTDQNYFGGSLEDLKDVSSELKIPVLRKDFILDEIQIREARAFGASAILLIVRILTPEQIKSFLKLASSLGMDCLVE 162
gi 116328897  83 VSVLTDRDYFGGSLEDLKNVSSELKIPILRKDFILNEVQIREARAFGASAILLIVRILTPAQIKTFLKSASSFGMDSLVE 162
gi 116330496  83 VSVLTDRDYFGGSLEDLKNVSSELKIPILRKDFILNEVQIREARAFGASAILLIVRILTPAQIKTFLKSASSFGMDSLVE 162
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 189910702 160 THNELEVNLALDAGANTIGINTRDLDTFQIHKNLIEEIAPKLDPSIIRVAESGIESYEDWQKYRGMIDSMLVGTFFMKSK 239
gi 183220594 160 THNELEVNLALDAGANTIGINTRDLDTFQIHKNLIEEIAPKLDPSIIRVAESGIESYEDWQKYRGMIDSMLVGTFFMKSK 239
gi 45658617  163 VHTSDEAKLALDCGAEIIGINTRDLDTFQIHQNLVEEVSAFLPPNIVKVGESGIKKRSDLDTFRKLVDAALIGTYFMEKQ 242
gi 24213540  163 VHTSDEAKLALDCGAEIIGINTRDLDTFQIHQNLVEEVSAFLPPNIVKVGESGIKKRSDLDTFRKLVDAALIGTYFMEKQ 242
gi 116328897 163 VHTPDEAKLALDCGAEIIGINTRDLDTFQIHQNLVEEVTAFLPRNVVKVGESGVGSRSDLDRFRKLVNAALIGTYFMEKS 242
gi 116330496 163 VHTPDEAKLALDCGAEIIGINTRDLDTFQIHQNLVEEVTAFLPRNVVKVGESGVGSRSDLDRFRKLVNAALIGTYFMEKS 242
                        250
                 ....*....|
gi 189910702 240 NIQHDFFSLL 249
gi 183220594 240 NIQHDFFSLL 249
gi 45658617  243 DIRKAWLNLF 252
gi 24213540  243 DIRKAWLNLF 252
gi 116328897 243 DIRKAWLELF 252
gi 116330496 243 DIRKAWLELF 252
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap