Conserved Protein Domain Family
nrdF2

?
PRK13966: nrdF2 
ribonucleotide-diphosphate reductase subunit beta; Provisional
Statistics
?
PSSM-Id: 140022
View PSSM: PRK13966
Aligned: 9 rows
Threshold Bit Score: 600.554
Threshold Setting Gi: 148824239
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148824239   1 MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGA 80
gi 148662901   1 MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGA 80
gi 118469934   1 MSDGIKLIDRVSAINWNRLQDEKDAEVWHRLTGNFWLPEKVPVSNDIQSWHTLTDNEKQLTMRVFTGLTLLDTIQGTVGA 80
gi 118469232   1 MSDGIKLIDRVSAINWNRLQDEKDAEVWHRLTGNFWLPEKVPVSNDIQSWHTLTDNEKQLTMRVFTGLTLLDTIQGTVGA 80
gi 31794226    1 MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGA 80
gi 15842613    1 MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGA 80
gi 57117051    1 MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGA 80
gi 224991424   1 MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGA 80
gi 253797854   1 MTGNAKLIDRVSAINWNRLQDEKDAEVWDRLTGNFWLPEKVPVSNDIPSWGTLTAGEKQLTMRVFTGLTMLDTIQGTVGA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148824239  81 VSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVAST 160
gi 148662901  81 VSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVAST 160
gi 118469934  81 VSLIPDAVTPHEEAVLTNIAFMESVHAKSYSNIFSTLCSTAEIDDAFRWSEENPNLQRKAAIVMQYYRGDEPLKRKVAST 160
gi 118469232  81 VSLIPDAVTPHEEAVLTNIAFMESVHAKSYSNIFSTLCSTAEIDDAFRWSEENPNLQRKAAIVMQYYRGDEPLKRKVAST 160
gi 31794226   81 VSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVAST 160
gi 15842613   81 VSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVAST 160
gi 57117051   81 VSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVAST 160
gi 224991424  81 VSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVAST 160
gi 253797854  81 VSLIPDALTPHEEAVLTNIAFMESVHAKSYSQIFSTLCSTAEIDDAFRWSEENRNLQRKAEIVLQYYRGDEPLKRKVAST 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148824239 161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE 240
gi 148662901 161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE 240
gi 118469934 161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKYQRGLALVDEEKKQELKDYTYELLFELYDNEVE 240
gi 118469232 161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKYQRGLALVDEEKKQELKDYTYELLFELYDNEVE 240
gi 31794226  161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE 240
gi 15842613  161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE 240
gi 57117051  161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE 240
gi 224991424 161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE 240
gi 253797854 161 LLESFLFYSGFYLPMYWSSRAKLTNTADMIRLIIRDEAVHGYYIGYKFQRGLALVDDVTRAELKDYTYELLFELYDNEVE 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 148824239 241 YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDD 320
gi 148662901 241 YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDD 320
gi 118469934 241 YTQDLYDSVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALAPNADENHDFFSGSGSSYVIGKAVNTEDE 320
gi 118469232 241 YTQDLYDSVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALAPNADENHDFFSGSGSSYVIGKAVNTEDE 320
gi 31794226  241 YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDD 320
gi 15842613  241 YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDD 320
gi 57117051  241 YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDD 320
gi 224991424 241 YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDD 320
gi 253797854 241 YTQDLYDEVGLTEDVKKFLRYNANKALMNLGYEALFPRDETDVNPAILSALSPNADENHDFFSGSGSSYVIGKAVVTEDD 320

                 ....
gi 148824239 321 DWDF 324
gi 148662901 321 DWDF 324
gi 118469934 321 DWDF 324
gi 118469232 321 DWDF 324
gi 31794226  321 DWDF 324
gi 15842613  321 DWDF 324
gi 57117051  321 DWDF 324
gi 224991424 321 DWDF 324
gi 253797854 321 DWDF 324
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap