Conserved Protein Domain Family
nrdF1

?
PRK13967: nrdF1 
ribonucleotide-diphosphate reductase subunit beta; Provisional
Statistics
?
PSSM-Id: 140023
View PSSM: PRK13967
Aligned: 7 rows
Threshold Bit Score: 654.875
Threshold Setting Gi: 57116932
Created: 9-Dec-2010
Updated: 17-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57116932    1 MTGKLVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVA 80
gi 15841457    1 MTGKLVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVA 80
gi 31793160    1 MTGKRVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVA 80
gi 148661790   1 MTGKLVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVA 80
gi 148823195   1 MTGKLVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVA 80
gi 224990358   1 MTGKRVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVA 80
gi 253798971   1 MTGKLVERVHAINWNRLLDAKDLQVWERLTGNFWLPEKIPLSNDLASWQTLSSTEQQTTIRVFTGLTLLDTAQATVGAVA 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57116932   81 MIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVML 160
gi 15841457   81 MIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVML 160
gi 31793160   81 MIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVML 160
gi 148661790  81 MIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVML 160
gi 148823195  81 MIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVML 160
gi 224990358  81 MIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVML 160
gi 253798971  81 MIDDAVTPHEEAVLTNMAFMESVHAKSYSSIFSTLCSTKQIDDAFDWSEQNPYLQRKAQIIVDYYRGDDALKRKASSVML 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57116932  161 ESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA 240
gi 15841457  161 ESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA 240
gi 31793160  161 ESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA 240
gi 148661790 161 ESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA 240
gi 148823195 161 ESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA 240
gi 224990358 161 ESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA 240
gi 253798971 161 ESFLFYSGFYLPMYWSSRGKLTNTADLIRLIIRDEAVHGYYIGYKCQRGLADLTDAERADHREYTCELLHTLYANEIDYA 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 57116932  241 HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDW 320
gi 15841457  241 HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDW 320
gi 31793160  241 HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDW 320
gi 148661790 241 HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDW 320
gi 148823195 241 HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDW 320
gi 224990358 241 HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDW 320
gi 253798971 241 HDLYDELGWTDDVLPYMRYNANKALANLGYQPAFDRDTCQVNPAVRAALDPGAGENHDFFSGSGSSYVMGTHQPTTDTDW 320

                 ..
gi 57116932  321 DF 322
gi 15841457  321 DF 322
gi 31793160  321 DF 322
gi 148661790 321 DF 322
gi 148823195 321 DF 322
gi 224990358 321 DF 322
gi 253798971 321 DF 322
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap