Conserved Protein Domain Family
PTZ00013

?
PTZ00013: PTZ00013 
plasmepsin 4 (PM4); Provisional
Statistics
?
PSSM-Id: 140051
View PSSM: PTZ00013
Aligned: 3 rows
Threshold Bit Score: 878.551
Threshold Setting Gi: 221060540
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156102356   1 MDIAVKEQDYSNGLIKNSAAFENLKFSNIKNFKVQKRFQILYYILFVFVTGIFFFFLISTYFftPNYKVNKIVQNTEHLT 80
gi 124808170   1 MALTVKEEEFSNTLIKNASAFDRLKLGNLKNLKIQKKLQFLYLILFVLITGVFFFFLIGNFY--SHRKLYQVIKNTKHTT 78
gi 221060540   1 MDIAVKEQDYSNGLIKNSAAFENLKFSNIKNFKVQKRFQILYFILFVFVTGIFFFFLISTYFfsPNYNVNKIVQNTEHLT 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156102356  81 LAFKIERPYDKVLKTISKKNLKNYIKETFNFFKSGYMKQNYLGSENDVIELDDVANIMFYGEGEVGDNHQKFMLIFDTGS 160
gi 124808170  79 IGFKIDRPHDKVLSSVLKNKLSTYVKESFKFFKSGYAQKGYLGSENDSIELDDVANLMFYGEGQIGTNKQPFMFIFDTGS 158
gi 221060540  81 LAFKIERPYDKVLKTISKKNLKNYVKETYNFFKSGYMKQNYLGSENDVIELDDVANIMFYGEGEVGDNHQKFTLIFDTGS 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156102356 161 ANLWVPSKKCNSSGCSIKNLYDSSKSKSYEKDGTKVDITYGSGTVKGFFSKDLVTLGHLSMPYKFIEVTDTDDLEPIYSS 240
gi 124808170 159 ANLWVPSVNCDSIGCSTKHLYDASASKSYEKDGTKVEISYGSGTVRGYFSKDVISLGDLSLPYKFIEVTDADDLEPIYSG 238
gi 221060540 161 ANLWVPSKKCTSLGCHIKNLYDSSKSKTYEKDGTKVDITYGSGTVKGFFSKDLVTLGHLSMPYKFIEVTDTDELEPIYSS 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156102356 241 VEFDGILGLGWKDLSIGSIDPIVVELKNQNKIDNALFTFYLPVHDVHAGYLTIGGIEEKFYEGNITYEKLNHDLYWQIDL 320
gi 124808170 239 SEFDGILGLGWKDLSIGSIDPVVVELKKQNKIDNALFTFYLPVHDKHVGYLTIGGIESDFYEGPLTYEKLNHDLYWQIDL 318
gi 221060540 241 TEFDGILGLGWKDLSIGSIDPIVVELKNQNKIDNALFTFYLPIHDVHAGYLTIGGIEEKFYEGNITYEKLNHDLYWQIDL 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156102356 321 DVHFGKQTMEKANVIVDSGTTTITAPSEFLNKFFANLNVIKVPFLPFYVTTCDNKEMPTLEFKSANNTYTLEPEYYMNPI 400
gi 124808170 319 DIHFGKYVMQKANAVVDSGTSTITAPTSFLNKFFRDMNVIKVPFLPLYVTTCDNDDLPTLEFHSRNNKYTLEPEFYMDPL 398
gi 221060540 321 DVHFGKQTMQKANVIVDSGTTTITAPSEFLNKFFANLNVIKVPFLPFYVTTCDNKEMPTLEFKSANNTYTLEPEYYMNPL 400
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|
gi 156102356 401 LEVDDTLCMITMLPVDIDSNTFILGDPFMRKYFTVFDYDKESVGFAIAKN 450
gi 124808170 399 SDIDPALCMLYILPVDIDDNTFILGDPFMRKYFTVFDYEKESVGFAVAKN 448
gi 221060540 401 LDVDDTLCMITMLPVDIDTNTFILGDPFMRKYFTVFDYDNESVGFAIAKN 450
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap