Conserved Protein Domain Family
PTZ00033

?
PTZ00033: PTZ00033 
60S ribosomal protein L24; Provisional
Statistics
?
PSSM-Id: 140068
View PSSM: PTZ00033
Aligned: 14 rows
Threshold Bit Score: 140.145
Threshold Setting Gi: 156102655
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71403927    1 MRTIDCEFSHFAVHPGHGRRYVPFAFLSTKPVLTFARPKCFAMYMRKKNPRFVPWTRTYRRINRKMTTDRVGRRRAARTV 80
gi 71666179    1 MRTIDCEFSHFAVHPGHGRRYVPFAFLSTKPVLTFARPKCFAMYMRKKNPRFVPWTRTYRRINRKMTTDRVGRRRAARTV 80
gi 71747474    1 MRTIDCEFSHFAVHPGHGRRYVPFAFLSTKPVLTFARPKCFAMYMRKKNPRFIAWTRTYRRIHRKTTTDRVGRRRAARTV 80
gi 71747470    1 MRTIDCEFSHFAVHPGHGRRYVPFAFLSTKPVLTFARPKCFAMYMRKKNPRFIAWTRTYRRIHRKTTTDRVGRRRAARTV 80
gi 124512926   8 VKTEACSFSEYRIYPGRGQKYIA----RDGKVYFYLSSKFASLALQKKKAAKLRWTQTWRRNNKKTKIETTQRRRYKKTI 83
gi 146103156   1 MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYMRKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAV 80
gi 154345610   1 MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYMRKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAV 80
gi 154345616   1 MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYMRKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAV 80
gi 157876669   1 MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYMRKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAV 80
gi 157876676   1 MRTIECEFSHFAVHPGHGRRYVPFAFLSTKPVLTFSRPKCFALYMRKKNPRFIPWTRTYRRIHRKTTTDRVNRRRAARAV 80
                         90       100       110       120
                 ....*....|....*....|....*....|....*....|....*
gi 71403927   81 KVERGIVGADLSYIQEVRAKTKKVDRSAKGKAVRAEMAERKAAKK 125
gi 71666179   81 KVERGIVGADLSYIQEVRAKTKKVDRSAKGKAVRAEMAERKAAKK 125
gi 71747474   81 RAERAIVGAELSYIQEVRAKAKKVDRTAKGKAVREEMAARKAAKK 125
gi 71747470   81 RTERAIVGAELSYIQEVRAKAKKVDRTAKGKAVREEMAARKAAKK 125
gi 124512926  84 KVQKAVCGLTVEDIRNRKAYVQSIEAKNKAKFGTKEKEDKKKTKD 128
gi 146103156  81 RVQRAIVGADLSYIQEVRA-ARKEDRSAKAKAIRAEVAERKAAKK 124
gi 154345610  81 RVQRAIVGADLSYIQEVRA-TRKVDRSAKAKAVRAEVAERKAAKK 124
gi 154345616  81 RVQRAIVGADLSYIQEVRA-TRKVDRSAKAKAVRAEVAERKAAKK 124
gi 157876669  81 RVQRAIVGADLSYIQEVRA-ARKEDRSAKAKAVRAEVAERKAAKK 124
gi 157876676  81 RVQRAIVGADLSYIQEVRA-ARKEDRSAKAKAVRAEVAERKAAKK 124
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap