Conserved Protein Domain Family
PTZ00179

?
PTZ00179: PTZ00179 
60S ribosomal protein L9; Provisional
Statistics
?
PSSM-Id: 140206
View PSSM: PTZ00179
Aligned: 12 rows
Threshold Bit Score: 338.832
Threshold Setting Gi: 72390583
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71403977    1 MKIRAQDRITYPEDVELSVKDRIVTVKGKRGTLTKDLRHLQLDFRVNKKFRTFTAVRWFGTKIDNSTINTALSHVRNMIT 80
gi 71407652    1 MKIRAQDRITYPEDVEVSVKDRIVTVKGKRGTLTKDLRHLQLDFRVNKKFRTFTAVRWFGTKIDNSTINTALSHVRNMIT 80
gi 71746626    1 MKIKSHDQITFPEDVTVSVKDRIVTVKGKRGTLTKDLRHLQLDFRVNKKLRTFTAVRWFGNKINNSTINTALSHVRNMIT 80
gi 71649657    1 MKIRAQDRITYPEDVELSVKDRIVTVKGKRGTLTKDLRHLQLDFRVNKKFRTFTAVRWFGTKIDNSTINTALSHVRNMIT 80
gi 71661487    1 MKIRAQDRITYPEDVEVSVKDRIVTVKGKRGTLTKDLRHLQLDFRVNKKFRTFTAVRWFGTKIDNSTINTALSHVRNMIT 80
gi 72390583    1 MKIKSHDQITFPEDVTVSVKDRIVTVKGKRGTLTKDLRHLQLDFRVNKKLRTFTAVRWFGNKINNSTINTALSHVRNMIT 80
gi 146094152   2 VKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLDLRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVQNMIT 81
gi 146094260   2 VKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLDLRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVQNMIT 81
gi 154337200   2 VKIKSFSTLEIPEGVTVEVRGRKVTVTGKRGTLTKDLSHLQLDFRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVLNMIT 81
gi 154342021   2 VKIKSFSTLEIPEGVTVEVRGRKVTVTGKRGTLTKDLSHLQLDFRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVLNMIT 81
gi 157869010   2 VKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLDLRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVQNMIT 81
gi 157872833   2 VKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLDLRVDKKNRTFTVIRWFGSKIPIACLNTTKAHVQNMIT 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71403977   81 GVTRGFRFKIRFAYAHFPISVSVENQLVEIRNFLGEKRVRRQVVADGVKVYRTDPTVVKDELVLEGNDLEEVSREAAVMH 160
gi 71407652   81 GVTRGFRFKIRFAYAHFPISVSVENQLVEIRNFLGEKRVRRQVVADGVKVYRTDPTVVKDELVLEGNDLEEVSREAAVMH 160
gi 71746626   81 GVTKGFRFKVRFAYAHFPISVTVENQLVEIRNFLGEKRVRRQVVADDVKVYRTDAALVKDELVLEGNDLEQVSREAAVMH 160
gi 71649657   81 GVTRGFRFKIRFAYAHFPISVSVENQLVEIRNFLGEKRVRRQVVADGVKVYRTDPTVVKDELVLEGNDLEEVSREAAVMH 160
gi 71661487   81 GVTRGFRFKIRFAYAHFPISVSVENQLVEIRNFLGEKRVRRQVVADGVKVYRTDPTVVKDELVLEGNDLEEVSREAAVMH 160
gi 72390583   81 GVTKGFRFKVRFAYAHFPISVTVENQLVEIRNFLGEKRVRRQVVADDVKVYRTDAALVKDELVLEGNDLEQVSREAAVMH 160
gi 146094152  82 GVTKGYRFKVRCAYAHFPINVSVDGQNIEVRNFLGEKRVRRQLVPSSVKVSQTDPSKVKDEIIFDGNDLEQVSREAAVLH 161
gi 146094260  82 GVTKGYRFKVRCAYAHFPINVSVDGQNIEVRNFLGEKRVRRQLVPSSVKVSQTDPSKVKDEIIFDGNDLEQVSREAAVLH 161
gi 154337200  82 GVTKGYRFKVRCAYAHFPINVSLDGPNIEVRNFLGEKRVRRQTVPSTVKVSQTDPSKVKDEIVFDGNDLEQVSREAAVLH 161
gi 154342021  82 GVTKGYRFKVRCAYAHFPINVSLDGPNIEVRNFLGEKRVRRQTVPSTVKVSQTDPSKVKDEIVFDGNDLEQVSREAAVLH 161
gi 157869010  82 GVTKGYRFKVRCAYAHFPINVSVDGQNIEVRNFLGEKRVRRQLVPNTVKVSQTDPSKVKDEIVFDGNDLEQVSREAAVLH 161
gi 157872833  82 GVTKGYRFKVRCAYAHFPINVSVDGQNIEVRNFLGEKRVRRQLVPNTVKVSQTDPSKVKDEIVFDGNDLEQVSREAAVLH 161
                        170       180
                 ....*....|....*....|....*....
gi 71403977  161 QLCLVKKKDIRKFLDGIYVQTKTNVVTEE 189
gi 71407652  161 QLCLVKKKDIRKFLDGIYVQTKTNVVAEE 189
gi 71746626  161 QLCLVKKKDIRKFLDGIYVQTKTNIEVDE 189
gi 71649657  161 QLCLVKKKDIRKFLDGIYVQTKTNVVAEE 189
gi 71661487  161 QLCLVKKKDIRKFLDGIYVQTKTNVVAEE 189
gi 72390583  161 QLCLVKKKDIRKVL-GRHLRADKDQHRS- 187
gi 146094152 162 QMCLVKKKDIRKFLDGIYVQTKTNIEGAE 190
gi 146094260 162 QMCLVKKKDIRKFLDGIYVQTKTNIEGME 190
gi 154337200 162 QMCLVRKKDIRKFLDGIYVQTKTNVEAVE 190
gi 154342021 162 QMCLVRKKDIRKFLDGIYVQTKTNVEAVE 190
gi 157869010 162 QMCLVKKKDIRKFLDGIYVQTKTNIEGME 190
gi 157872833 162 QMCLVKKKDIRKFLDGIYVQTKTNIEGTE 190
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap