Conserved Protein Domain Family
PTZ00181

?
PTZ00181: PTZ00181 
60S ribosomal protein L38; Provisional
Statistics
?
PSSM-Id: 140208
View PSSM: PTZ00181
Aligned: 13 rows
Threshold Bit Score: 117.895
Threshold Setting Gi: 71399596
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71409569   1 MPREIKSLKEFLAICSRKDARCVKVKHNPAQTKFKVRCSRHLYTLVVADRKKADKIERSIHPSVKKITVTARSHAKTNAG 80
gi 71412451   1 MPREIKSLKEFLAICSRKDARCVKVKHNPTQTKFKVRCSRYLYTLVVADKKKADKIERSIHPSVKKITVTARSHAKTNAG 80
gi 71399596   1 MPREIKSVKEFLAICSRKDARCVKVKHNPTQTKFKVRCSRYLYTLVVADKKKADKIERSIHPSVKKITAPPH-------- 72
gi 71657151   1 MPREIKSLKEFLAICSRKDARCVKVKHNPTQTKFKVRCSRYLYTLVVADKKKADKIERSIHPSVKKITVTARSHAKTNAG 80
gi 71655931   1 MPREIKNLKEFLAICSRKDARCVKVKHNPAQTKFKVRCSRYLYTLVVADKKKADKIERSIHPSVKKITVTARSHAKTNAG 80
gi 71744028   1 MPREIKNLKEFLAICSRKDARCVKVKHNPKVTKFKVRCSRHLYTLVMADKKKADKIERSIHPSVKKITVTSRSHANKNTP 80
gi 71747048   1 MPREIKNLKEFLAICSRKDVRCVKVKHNPKVTKFKVRCSRYLYTLVMADKKKADKIERSIHPTVKKITVTARSHAKKNTP 80
gi 154331597  1 MPREIKTLKEFLAICSRKDARCVKVKRNPSATKFKVRCSRYLYTLVVNDKKKADKIERSIHPSVKKIAVTARSHAKTNAG 80
gi 146090414  1 MPREIKTLKEFLAICSRKDARCVKVKHNPSATKFKVRCSRYLYTLVVNDKKKADKIERSIHPSVKKIAVTARSHAKTNAG 80
gi 146075806  1 MPREIKTLKEFLAICSRKDARCVKVKHNPSATKFKVRCSRYLYTLVVNDKKKADKIERSIHPSVKKIAVTARSHAKTNAG 80
gi 154339505  1 MPREIKTLKEFLAVCSRKDARCVKVKRNPSATKFKVRCSRYLYTLVVNDKKKADKIERSIHPSVKKIAVTARSHAKTNAG 80
gi 157871357  1 MPREIKTLKEFLAICSRKDARCVKVKHNPSATKFKVRCSRYLYTLVVNDKKKADKIERSIHPSVKKIAVTARSHAKTNAG 80
gi 157878982  1 MPREIKTLKEFLAICSRKDARCVKVKHNPSATKFKVRCSRYLYTLVVNDKKKADKIERSIHPSVKKIAVTARSHAKTNAG 80

                ..
gi 71409569  81 SK 82
gi 71412451  81 SK 82
gi 71399596     --
gi 71657151  81 SK 82
gi 71655931  81 SK 82
gi 71744028  81 SK 82
gi 71747048  81 SK 82
gi 154331597 81 TK 82
gi 146090414 81 SK 82
gi 146075806 81 SK 82
gi 154339505 81 TK 82
gi 157871357 81 SK 82
gi 157878982 81 SK 82
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap