Conserved Protein Domain Family
PTZ00185

?
PTZ00185: PTZ00185 
ATPase alpha subunit; Provisional
Statistics
?
PSSM-Id: 140212
View PSSM: PTZ00185
Aligned: 6 rows
Threshold Bit Score: 1043.85
Threshold Setting Gi: 72392136
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72392136    1 MRRFGSKFASGLASRCAlacplasaatapAGASTTSSTSSAQKSFFKTTEMIGYVHSIDGTIATLIPAPGNPGVAYNTII 80
gi 72392138    1 MRRFGSKFASGLASRCAlacplasaatapAGASTTSSTSSAQKSFFKTTEMIGYVHSIDGTIATLIPAPGNPGVAYNTII 80
gi 146076833   1 MRRFVAQYVAPAMGRLA------------STAAAGKSAAPGQKSFFKATEMIGYVHSIDGTIATLIPAPGNPGVAYNTII 68
gi 154332099   1 MRRFVAQHMAPAVARLA------------STAAASKSAAPGQKSFFKATEMIGYVHSIDGTIATLIPAPGNPGVAYNTII 68
gi 157863955   1 MRRFVAQYVAPAMGRLA------------STAAAGKSAAPGQKSFFKATEMIGYVHSIDGTIATLIPAPGNPGVAYNTII 68
gi 157863958   1 MRRFVAQYVAPAMGRLA------------STAAAGKSAAPGQKSFFKATEMIGYVHSIDGTIATLIPAPGNPGVAYNTII 68
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72392136   81 QIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEVQSGQKVMATGQLLHIPVGAGVLGKVVNPLGHEVPVGLVTRSRRLLD 160
gi 72392138   81 QIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEVQSGQKVMATGQLLHIPVGAGVLGKVVNPLGHEVPVGLVTRSRRLLD 160
gi 146076833  69 MIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEVQSGQKVMATGKLLYIPVGAGVLGKVVNPLGHEVPVGLLTRSRALLE 148
gi 154332099  69 MIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEVQSGQKVMATGKLLYIPVGTGVLGKVVNPLGHEVPVGLFTRSRALLE 148
gi 157863955  69 MIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEVQSGQKVMATGKLLYIPVGAGVLGKVVNPLGHEVPVGLLTRSRALLE 148
gi 157863958  69 MIQVSPTTFAAGLVFNLEKDGRIGIILMDNITEVQSGQKVMATGKLLYIPVGAGVLGKVVNPLGHEVPVGLLTRSRALLE 148
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72392136  161 S--TLGKVDTGAPNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRINQQILSKNAVIS 238
gi 72392138  161 S--TLGKVDTGAPNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRINQQILSKNAVIS 238
gi 146076833 149 SeqTLGKVDAGAPNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRSNQQILSKNAVIS 228
gi 154332099 149 SeqTLGKVDAGAPNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRINQQILSKNAVIS 228
gi 157863955 149 SeqTLGKVDAGAPNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRSNQQILSKNAVIS 228
gi 157863958 149 SeqTLGKVDAGAPNIVSRSPVNYNLLTGFKAVDTMIPIGRGQRELIVGDRQTGKTSIAVSTIINQVRSNQQILSKNAVIS 228
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72392136  239 IYVSIGQRCSNVARIHRLLQSYGALRYTTVMAATAAEPAGLQYLAPYAGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQI 318
gi 72392138  239 IYVSIGQRCSNVARIHRLLQSYGALRYTTVMAATAAEPAGLQYLAPYAGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQI 318
gi 146076833 229 IYVSIGQRCSNVARIHRLLRSYGALRYTTVMAATAAEPAGLQYLAPYSGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQI 308
gi 154332099 229 IYVSIGQRCSNVARIHRLLRSYGALRYTTVMAATAAEPAGLQYLAPYSGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQI 308
gi 157863955 229 IYVSIGQRCSNVARIHRLLRSYGALRYTTVMAATAAEPAGLQYLAPYSGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQI 308
gi 157863958 229 IYVSIGQRCSNVARIHRLLRSYGALRYTTVMAATAAEPAGLQYLAPYSGVTMGEYFMNRGRHCLCVYDDLSKQAVAYRQI 308
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72392136  319 SLLLRRPPGREAYPGDVFYLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQ 398
gi 72392138  319 SLLLRRPPGREAYPGDVFYLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQ 398
gi 146076833 309 SLLLRRPPGREAYPGDVFYLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQ 388
gi 154332099 309 SLLLRRPPGREAYPGDVFYLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQ 388
gi 157863955 309 SLLLRRPPGREAYPGDVFYLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQ 388
gi 157863958 309 SLLLRRPPGREAYPGDVFYLHSRLLERAAMLSPGKGGGSVTALPIVETLSNDVTAYIVTNVISITDGQIYLDTKLFTGGQ 388
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72392136  399 RPAVNIGLSVSRVGSSAQNAAMKGVAGKLKGILAEYRKLAADSVGGQQVQTIPMIRGARFVALFNQKQPSYFMNAIVSLY 478
gi 72392138  399 RPAVNIGLSVSRVGSSAQNAAMKGVAGKLKGILAEYRKLAADSVGGQQVQTIPMIRGARFVALFNQKQPSYFMNAIVSLY 478
gi 146076833 389 RPAVNIGLSVSRVGSSAQNVAMKAVAGKLKGILAEYRKLAADSVGGSQVQTVPMIRGARFVALFNQKNPSFFMNALVSLY 468
gi 154332099 389 RPAVNIGLSVSRVGSSAQNVAMKAVAGKLKGILAEYRKLAADSVGGSQVQTVPMIRGARFVALFNQKNPSFFMNALVSLY 468
gi 157863955 389 RPAVNIGLSVSRVGSSAQNVAMKAVAGKLKGILAEYRKLAADSVGGSQVQTVPMIRGARFVALFNQKNPSFFMNALVSLY 468
gi 157863958 389 RPAVNIGLSVSRVGSSAQNVAMKAVAGKLKGILAEYRKLAADSVGGSQVQTVPMIRGARFVALFNQKNPSFFMNALVSLY 468
                        490       500       510       520       530       540       550       560
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72392136  479 ACLNGYLDDVKVQYVKFYEYLLVHRDLGIMYGTAKNKFFYMYVQELNYLIRFFTLNSPILHGELEEMLKQHTHLFLQHYQ 558
gi 72392138  479 ACLNGYLDDVKVQYVKFYEYLLVHRDLGIMYGTAKNKFFYMYVQELNYLIRFFTLNSPILHGELEEMLKQHTHLFLQHYQ 558
gi 146076833 469 ACLNGYLDDVKVNYAKLYEYLLVNKDLSVMYGTATNKFFYMYVQQLNYVIRFFTLNHPILNAEVEEMLKQHTHLFLQHYQ 548
gi 154332099 469 ACLNGYLDDVKVNYAKLYEYLLVNKDLSVMYGTATNKFFYMYVQQLNYVIRFFTLSHPVLNAEVEEMLKQHTHLFLQHYQ 548
gi 157863955 469 ACLNGYLDDVKVNYAKLYEYLLVNKDLSVMYGTATNKFFYMYVQQLNYVIRFFTLNHPILNAEVEEMLKQHTHLFLQHYQ 548
gi 157863958 469 ACLNGYLDDVKVNYAKLYEYLLVNKDLSVMYGTATNKFFYMYVQQLNYVIRFFTLNHPILNAEVEEMLKQHTHLFLQHYQ 548
                        570       580
                 ....*....|....*....|....*.
gi 72392136  559 SKMNAIKSEKDVKALKNLLYSCKRAV 584
gi 72392138  559 SKMNAIKSEKDVKALKNLLYSCKRAV 584
gi 146076833 549 SKMNAIKTEKEIKALKNLLYSCKRAV 574
gi 154332099 549 SKMNAIKTEKEIKALKNLLYSCKRAV 574
gi 157863955 549 SKMNAIKTEKEIKALKNLLYSCKRAV 574
gi 157863958 549 SKMNAIKTEKEIKALKNLLYSCKRAV 574
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap