Conserved Protein Domain Family
PTZ00190

?
PTZ00190: PTZ00190 
60S ribosomal protein L29; Provisional
Statistics
?
PSSM-Id: 140217
View PSSM: PTZ00190
Aligned: 11 rows
Threshold Bit Score: 80.487
Threshold Setting Gi: 71664403
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71402083   1 MAKSKNHTNHNQSRKNHRNGIKRALPMYLHNSKRGSWLPALINARRVRKNNQKAAVKARRERLAAHKAKQ 70
gi 71402085   1 MAKSKNHTNHNQSRKNHRNGIKRALPMYLHNSKRGSWLPALINARRVRKNNQKAAVKARRERLAAHKAKQ 70
gi 71664403   1 MAKSKNHTNHNQSRKNHRNGIKRALPMYLHNSKRGSWLPALINARRVRKNNQKAAVKARRERLAAHNAKQ 70
gi 71664461   1 MAKSKNHTNHNQSRKNHRNGIKRALPMYLHNSKRGSWLPALINARRVRKNNQKAAVKARRERLAAHNAKQ 70
gi 74025002   1 MAKSKNHTNHNQSRKNHRNGIKPPLPLYMYNSKRGGWLPALVNTRRVRKNNQKAALKARRERLAAHQAAQ 70
gi 146103913  1 MAKSKNHTNHNQSSKNHRNGIKGPMPLHLRNSKRGSWLPALVNARRVRKHNQKAALKKRRERIAAFASKN 70
gi 146103917  1 MAKSKNHTNHNQSSKNHRNGIKGPMPLHLHNSKRGSWLPALVNARRVRKHNQKAALKKRRERIAAFAAKN 70
gi 157877177  1 MAKSKNHTNHNQSSKNHRNGIKGPVPLHLHNSKRGSWLPALVNARRVRKHNQKAALKKRRERIAAFAAKN 70
gi 157877179  1 MAKSKNHTNHNQSSKNHRNGIKGPVPLHLHNSKRGSWLPALVNARRVRKHNQKAALKKRRERIAAFAAKN 70
gi 154346088  1 MAKSKNHTNHNQSSKNHRNGIKGPMPLHLCNSKRGGWLPALVNTRRVRKHNQKAALKRRRERIAAFAAKN 70
gi 154346090  1 MAKSKNHTNHNQSSKNHRNGIKGPMPLHLCNSKRGGWLPALVNTRRVRKHNQKAALKRRRERIAAFAAKN 70
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap