Conserved Protein Domain Family
PTZ00193

?
PTZ00193: PTZ00193 
60S ribosomal protein L31; Provisional
Statistics
?
PSSM-Id: 140220
View PSSM: PTZ00193
Aligned: 11 rows
Threshold Bit Score: 290.01
Threshold Setting Gi: 146101529
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71413116    1 MTRAGFKGKLLGKERKQALLDARKKAVASRKARDDRRWKRVLAKMDSEKRKKYHGVGNTAEHSRVRGITRAALRKRTGRK 80
gi 71411582    1 MTRAGFKGKVLGKERKQALLDARKKAVASRKARDDRRWKRVLAKMDSEKRKKYHGVGNTAEHSRVRGITRAALRKRTGRK 80
gi 71411570    1 MTRAGFKGKVLGKERKQALLDARKKAVASRKARDDRRWKRVLAKMDSEKRKKYHGVGNTAEHSRVRGITRAALRKRTGRK 80
gi 71413124    1 MTRAGFKGKLLGKERKQALLDARKKAVASRKARDDRRWKRVLAKMDSEKRKKYHGVGNTAEHSRVRGITRAALRKRTGRK 80
gi 71745682    1 MTRAGFKGKVLGKEKKLALLEARKKAAEARKSRDDRRWKRVLAKMDPEKRKKYHGVGNTAEHSRVRGCTRASLFKRTGRK 80
gi 71745684    1 MTRAGFKGKVLGKEKKLALLEARKKAAEARKSRDDRRWKRVLAKMDPEKRKKYHGVGNTAEHSRVRGCTRASLFKRTGRK 80
gi 72548801    1 MTRAGMKGKVLGKEKKAAIIDARKKAAESRKNRDDKRWKRVLANMDEEKRKKFHGVGNTAKNSRVRGATRASLLKRTGRK 80
gi 72548811    1 MTRAGMKGKVLGKEKKAAIIDARKKAAESRKNRDDKRWKRVLANMDEEKRKKFHGVGNTAKNSRVRGATRASLLKRTGRK 80
gi 146101529   1 -----MKGKVLGKEKKAAIIDARKKDAESRKNRDDKRWKRVLANMDEEKRKKFHGVGNTAKNSRVRGATRASLRKRTGRK 75
gi 154344967   1 MTRAGMKGKVLGKEKKIAIIDARKKAVESRRSRDDKRWKRVIARMDEEKRKRFHGVGNTAKNSRARGTTRASLRKRTGRK 80
gi 154344969   1 MTRAGMKGKVLGKEKKIAIIDARKKAVESRRSRDDKRWKRVIARMDEEKRKRFHGVGNTAKNSRARGTTRASLRKRTGRK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71413116   81 PDNITMEATIHLSKLLKRKTFHKRAPIAIKRIKAFVARLMKTKDNRIDASLNTYVWHKGVKGVPGRVRVHVERKSETLEG 160
gi 71411582   81 PDNITMEATIHLSKLLKRKTFHKRAPIAIKRIKAFVARLMKTKDNRIDASLNTYVWHKGVKGVPGRVRVHVERKSETLEG 160
gi 71411570   81 PDNITMEATIHLSKLLKRKTFHKRAPIAIKRIKAFVARLMKTKDNRIDASLNTYVWHKGVKGVPGRVRVHVERKSETLEG 160
gi 71413124   81 PDNITMEATIHLSKLLKRKTFHKRAPIAIKRIKAFVARLMKTKDNRIDASLNTYVWHKGVKGVPGRVRVHVERKSETLEG 160
gi 71745682   81 PDNIVMEASIHLSKLLKKRTFHKRAPIAIKRIRSFVGKLMKTKDNRIDASLNTFIWHKGVKGVPGRVRVRVERKSETMEG 160
gi 71745684   81 PDNIVMEASIHLSKLLKKRTFHKRAPIAIKRIRSFVGKLMKTKDNRIDASLNTFIWHKGVKGVPGRVRVRVERKSETMEG 160
gi 72548801   81 PDAVSMEATIHLSKLLKKKTFSKRAPLAIKRIKAFVGRLMKTKDNRIDASLNTYIWHKGVKGVPGRVRVLIQRKSETTEG 160
gi 72548811   81 PDAVSMEATIHLSKLLKKKTFSKRAPLAIKRIKAFVGRLMKTKDNRIDASLNTYIWHKGVKGVPGRVRVLIQRKSETTEG 160
gi 146101529  76 PDAVSMEATIHLSKLLKKKTFSKRAPLAIKRIKAFVGRLMKTKDNRIDASLNTYIWHKGVKGVPGRVRVLIQRKSETTEG 155
gi 154344967  81 PDAVSMEATIHLSKLLKKKTFAKRAPLAIKRIKAFVGRLMKTKDNRIDASLNTYIWHKGVKGVPGRVRVLIQRKSETAEG 160
gi 154344969  81 PDAVSMEATIHLSKLLKKKTFAKRAPLAIKRIKAFVGRLMKTKDNRIDASLNTYIWHKGVKGVPGRVRVLIQRKSETAEG 160
                        170       180
                 ....*....|....*....|....*...
gi 71413116  161 GKRKHFYTVISNVPVASFKNLTTKVTEQ 188
gi 71411582  161 GKRKHFYTVISNVPVASFKNLTTKVTEQ 188
gi 71411570  161 GKRKHFYTVISNVPVASFKNLTTKVTEQ 188
gi 71413124  161 GKRKHFYTVISNVPVASFKNLTTKVTEQ 188
gi 71745682  161 GKRKHFYTVISHIPVPSFKNLTTKVIEQ 188
gi 71745684  161 GKRKHFYTVISHIPVPSFKNLTTKVIEQ 188
gi 72548801  161 NKHKHFYTVISNVPVASFKGLTTKTVEQ 188
gi 72548811  161 NKHKHFYTVISNVPVASFKGLTTKTVEQ 188
gi 146101529 156 NKHKHFYTVISNVPVASFKGLTTKTVEQ 183
gi 154344967 161 NKHKHFFTVISNVPVASFKGLTTKTVEQ 188
gi 154344969 161 NKHKHFFTVISNVPVASFKGLTTKTVEQ 188
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap