Conserved Protein Domain Family
PTZ00195

?
PTZ00195: PTZ00195 
60S ribosomal protein L18; Provisional
Statistics
?
PSSM-Id: 140222
View PSSM: PTZ00195
Aligned: 11 rows
Threshold Bit Score: 329.685
Threshold Setting Gi: 154346312
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154333852   1 MGVDLTGISKKSRVVRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAK 80
gi 71404909  131 MGVDLTGVQKKKRVVRHHTYSTNPYIKLLIKLYKFLAQRTNSGFNKLVHQRLLKSRSNRAPISLSRIAVCMKRKSVWLEK 210
gi 71650291  106 MGVDLTGVQKKKRVVRHHTYSTNPYIKLLIKLYKFLAQRTNSAFNKLVHQRLLKSRSNRAPISLSRIAVCMKRKSVWLEK 185
gi 71665719    1 MGVDLTGVQKKKRVVRHHTYSTNPYIKLLIKLYKFLAQRTNSAFNKLVHQRLLKSRSNRAPISLSRIAVCMKRKSVWLEK 80
gi 71755183    1 MGVDLTGVQKKKRVVRHHTYSTNPYIKLLIKLYKFLGKRTNSPFNKLIHKRLLKSRNNRAPISLSRIAVCMRRRTVWLKK 80
gi 71748310    1 MGVDLTGVQKKKRVVRHHTYSTNPYIKLLIKLYKFLGKRTNSPFNKLIHKRLLKSRNNRAPISLSRIAVCMRRRTVWLKK 80
gi 146080757   1 MGVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAK 80
gi 146104518   1 MGVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAK 80
gi 157877436   1 MGVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAK 80
gi 154346312   1 MGVDLTGISKKSRVVRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQRLIKSRSNRAPLSLSRIAVVMKRKAVFTAK 80
gi 157866188   1 MGVDLTGISKKSRVIRHHTYSTNPYIKLLIKLYKFLAKRTSSGFNKVVYQRLIKSRSNRAPISLSRIAVVMKRKAVFTAK 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154333852  81 CKKAPIAVVVGDVLDDVRMARIPAMRVCALRFSKNARQSIVAAGGECLTFDQLAMIAPTGKNTYLMRGRKSGRESVRHFG 160
gi 71404909  211 GKKAPIAVIVGDVLDDVRMTRIPALRVCALRFSKSARERITGAGGECLTFDQLAMVAPTGKNTFLLRGRKSGRESVKHFG 290
gi 71650291  186 GKKAPIAVIVGDVLDDVRMTRIPALRVCALRFSKSARERITGAGGECLTFDQLAMVAPTGKNTFLLRGRKSGRESVKHFG 265
gi 71665719   81 GKKAPIAVIVGDVLDDVRMARIPALRVCALRFSKSARERITGAGGECLTFDQLAMVAPTGKNTFLLRGRKSGRESVKHFG 160
gi 71755183   81 GKKSPIAVIVGDVLDDVRMTRIPALRICALRFSKSARERITGAGGECLTFDQLAMMAPTGKNTMLLRGRKSGRESVKHFG 160
gi 71748310   81 GKKSPIAVIVGDVLDDVRMTRIPALRICALRFSKSARERITGAGGECLTFDQLAMMAPTGKNTMLLRGRKSGRESVKHFG 160
gi 146080757  81 SKAAPIAVVVGDVLDDVRMARIPAMRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPTGKNTYLLRGRKSGRESVRHFG 160
gi 146104518  81 SKAAPIAVVVGDVLDDVRMARIPAMRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPTGKNTYLLRGRKSGRESVRHFG 160
gi 157877436  81 SKAAPIAVVVGDVLDDVRMARIPAMRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPTGKNTYLLRGRKSGRESVRHFG 160
gi 154346312  81 CKKAPIAVVVGDVLDDVRMARIPAMRVCALRFSKNARQSIVAAGGECLTFDQLAMIAPTGKNTYLMRGRKSGRESVRHFG 160
gi 157866188  81 SKAAPIAVVVGDVLDDVRMARIPAMRVCALRFSKSARQSIVAAGGECLTFDQLAMIAPTGKNTYLLRGRKSGRESVRHFG 160
                        170       180       190
                 ....*....|....*....|....*....|....*...
gi 154333852 161 ASGVPGSHSKPYATNRGKETKRGRRpgqsyKRKAFRHV 198
gi 71404909  291 AAGVPGSHAKPFTSNRGKERQRSSA-----RRRAFRHK 323
gi 71650291  266 AAGVPGSHAKPFTSNRGKERQRSSA-----RRRAFRHK 298
gi 71665719  161 AAGVPGSHAKPFTSNRGKERQRSSA-----RRRAFRHK 193
gi 71755183  161 AAGVPGSHAKPHVSSRGKERQRSSK-----RRHAFRHK 193
gi 71748310  161 AAGVPGSHAKPHVSSRGKERQRSSK-----RRHAFRHK 193
gi 146080757 161 ASGVPGSHSKPYATNRGKETKRGRRtgrsyKRKAFRHV 198
gi 146104518 161 ASGVPGSHSKPYATNRGKETKRGRRtgrsyKRKAFRHV 198
gi 157877436 161 ASGVPGSHSKPYATNRGKETKRGRRtgrsyKRKAFRHV 198
gi 154346312 161 ASGVPGSHSKPYATNRGKETKRGRRpgqsyKRKAFRHV 198
gi 157866188 161 ASGVPGSHSKPYATNRGKETKRGRRtgrsyKRKAFRHV 198
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap