Conserved Protein Domain Family
PTZ00205

?
PTZ00205: PTZ00205 
DNA polymerase kappa; Provisional
Statistics
?
PSSM-Id: 140232
View PSSM: PTZ00205
Aligned: 8 rows
Threshold Bit Score: 1215.25
Threshold Setting Gi: 71756019
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71756021   1 MCGGEENGGLDQAHVSYSGSASEQNIAEMIVDPSASRQPTAFQLTLDCNKAGMGNVDKERVEAIIRGAGEGTPFLLNEQR 80
gi 71756019   1 MCGGEENGGLDQAHVSYSGSASEQNIAEMIVDPSASRQPTAFQLTLDCNKAGMGNVDKERVAAVIHEMSAGSGYLCNQQR 80
gi 71756023   1 MCGGEENGGLDQAHVSYSGSASEQNIAEMIVDPSGSRQPTAFQLTLDCNKAGMGNVDKERVEAIIRNVSEGSSFLMNEQR 80
gi 71756025   1 MCGGEENGGLDQAHVSYSGSASEQNIAEMIVGPSGSRQPTAFQLTLDCNKAGMGNVDKERVEAIIRNVSEGSSFLMNEQR 80
gi 71756027   1 MCGGEENGGLDQAHVSYSGSASEQNIAEMIVDPSGSRQPTAFQLTLDCNKAGMGNVDKERVEAIIRNVSEGSSFLMNEQR 80
gi 71756033   1 MCGGEENGGLDQAHVSYSGSASEQNIAEMIVGPSAS-ITMGFPFSIDCNKAGMGNVDKERVEAIIRDAREGSPFLLNEQR 79
gi 71756035   1 MCGGEENGGLDQAHVSYSGSASEQNIAEMIVDPSGSRQPTAFQLTLDCNKAGMGNVDKERVEAIIRDAREGTPFLLNEQR 80
gi 71756037   1 MCGGEENGGLDQAHVSYSGSASEQNIAEMIVDPSGSRQPTAFQLTLDCNKAGMGNVDKERVEAIIRNVSEGSSFLMNEQR 80
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71756021  81 LVEGREKQLRELKRKSSLFTRLLGGERNAAQRTQWEVKVSKIEQELEATRRLGTYIHLDMDMFYAAVEIKKHPEYATIPL 160
gi 71756019  81 LSKSREKQLQELKRKSSLFTQLLGGERNAARRTQWEVKVSKIEQELEATRRLGTYIHLDMDMFYAAVEIKKHPEYANVPL 160
gi 71756023  81 KAEGREKQLQELKRKSSLFTQLLGGERNAARRKQWELKVSKIEQELEATRRLGTYIHLDMDMFYAAVEIKKHPEYANVPL 160
gi 71756025  81 KAEGREKQLQELKRKSSLFTQLLGGERNAAQRKQWELKVSKIEQELEATRRLGTYIHLDMDMFYAAVEIKKHPEYAAIPL 160
gi 71756027  81 KAEGREKQLQELKRKSSLFTRLLGGERNAAQRKQWELKVSKIEQELEATRRLGTYIHLDMDMFYAAVEIKKHPEYAAIPL 160
gi 71756033  80 LAEGREKQLQELKRKSSLFTQLLGGERNAAQRKQWELKVSKMEQELEATRRLGTYIHLDMDMFYAAVEIKKHPEYATIPL 159
gi 71756035  81 LAEGREKQLQELKRKSSLFTRLLGGERNAAQRKQWELKVSKIEQELEATRRLGTYIHLDMDMFYAAVEIKKHPEYATIPL 160
gi 71756037  81 LAEGREKQLQELKRKSSLFTQLLGGERNAAQRKQWELKVSKIEQELEATRRLGTYIHLDMDMFYAAVEIKKHPEYAAIPL 160
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71756021 161 AIGTMTRLQTANYIARGRGIRQGMPGFLALKICPNLLILPPDDDSYNEESNTVRRIVAEYDPNYIVVGLDELALEVSAYI 240
gi 71756019 161 AVGTKTMLTTANYVARGCGVRPGMPGYIGLKICPNLLILPPDFDTYNEESNTVRRIVAEYDPNYISFGLDELTLEVSAYI 240
gi 71756023 161 AVGSVSMLSTANYVARECGIRSGMPGYIGLKVCPNLLILPPDFDAYNEESNTVRRIVDEYDPNFTSLGLDDLTLEVSAYI 240
gi 71756025 161 AVGSVSMLSTANYVARECGIRSGMPGYIGLKVCPNLLILPPDFDAYNEESNTVRRIVAEYDPNFTSLGLDELTLEVSAYI 240
gi 71756027 161 AIGTITRLITTNYVARGRGIRQGMPGFLALKICPNLLILPPDFDAYNEESNTVRRIVAEYDPNYISFGLDDFTLEVSAYI 240
gi 71756033 160 AIGTMTRLQTANYIARGRGVRPGMPGFLALKICPNLLLLPPDDDSYYLESNIVRRIVAEYDPNYIVVGLDDFTLEVSAYI 239
gi 71756035 161 AIGTMTMIITTNYVARGRGIRQGMPGFLALKICPNLLLLPPDDDSYYLESNIVRRIVAEYDPNYIVVGLDDFTLEVSAYI 240
gi 71756037 161 AIGTMTRLQTANYIARGRGVRCSMPGFLALKICPNLLILPPDFDAYNEESNTVRRIVAEYDPNYISFGLDELTLEVSAYI 240
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71756021 241 ERFEGTKTAEDVASELRVRVFGETKLTASAGIGPTAALAKIASNINKPNGQHDLNLHTREDVMTYVRDLGLRSVPGVGKV 320
gi 71756019 241 ERFEGTKTAEDVASELRVRVFGETKLTASAGIGPTAALAKIASNINKPNGQHDLNLHTRGDVMTYVRDLGLRSVPGIGKA 320
gi 71756023 241 ERFEGTKTAEDVASELRVRVFGETKLTASAGIGPTAALAKIASNINKPNGQHDLNLHTRGDVMTYVRDLGLRSVPGVGKV 320
gi 71756025 241 ERFEGTKTAEDVASELRVRVFGETKLTASAGIGPTAALAKIASNINKPNGQHDLNLHTREDVMTYVRDLGLRSVPGIGKV 320
gi 71756027 241 ERFEGTKTAEDVASELRVRVFGETKLTASAGIGPTAALAKIASNINKPNGQHDLNLHTREDVMTYVRDLGLRSVPGVGKV 320
gi 71756033 240 ERFEGTKTAEDVASELRVRVFGETKLTASAGIGPTAALAKIASNINKPNGQHDLNLHTRGDVMTYVRDLGLRSVPGVGKV 319
gi 71756035 241 ERFEGTKTAEDVASELRVRVFGETKLTASAGIGPTAALAKIASNINKPNGQHDLNLHTRGDVMTYVRDLGLRSVPGVGKV 320
gi 71756037 241 ERFEGTKTAEDVASELRVRVFGDTKLTASAGIGPTAALAKIASNINKPNGQHDLNLHTREDVMTYVRDLGLRSVPGVGKV 320
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71756021 321 TEALLKGLGITTLSDIYNRRVELCYILHNNLFRFLLGASIGIMQWPDAATAANTeNCEGATGEQRKAISSERSITTPRTK 400
gi 71756019 321 MEALLKGLGITTLSDIYNRRVELCYIFTEKTYRFLLGASIGIMQWPDACNIPGG-SVDDGTGVGRKSVGSERTFKILQSK 399
gi 71756023 321 TEALLKGLGITTLSDIYNRRVELCYILHNNLFRFLLGASIGIMQWPDAATAANTeNCEGATGGQRKAISSERSFYVLHSK 400
gi 71756025 321 TEALLKGLGITTLSDIYNRRVELCYIFTEKTYCFLLGASIGIMQWPDMCSILGA-SIDDGTGVGRKSVGCERTFKTFQNK 399
gi 71756027 321 TEALLKGLGITTLSDIYNRRVELCYILHNNLFRFLLGASIGIMQWPDAATAANTeNCEGATGEQRKAISSERSITTPRTK 400
gi 71756033 320 TEALLKGLGITTLGDIHDRRVELCYILHNNLFRFLLGASIGIMQWPDAATAANTeNCEGATGGQRKAISSERSFYVLHSK 399
gi 71756035 321 TEALLKGLGITTLSDIYNRRVELCYILHNNLFRFLLGASIGIMQWPDAATAANTeNCEGATGEQRKAISSERSITTPRTK 400
gi 71756037 321 TEALLKGLGITTLSDIYNRRVELCYILHNNLFRFLLGASIGIVQWPDAATAANTeNCEGATGGQRKAISSERSITTPRTK 400
                       410       420       430       440       450       460       470       480
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71756021 401 EGMQEMVDTVFNGAYEEMRKSEIMCRRISLTIRWASYRYQQYTKSLIQHSDDSATLRRAVDELMLPHAAKYSEMCLLGVR 480
gi 71756019 400 EELQEIVDFIFNSSYDELKKHELMCRQVSLRIRWATYRSRQYTMNLAQHSDDSATLRRAVDGLLLPHAAKYSDMSLLGMR 479
gi 71756023 401 EQLHEMIYSIFEEAYEEMRQNEMLCRQISLLVRWSSYRYQQYTKSLIQYSDDSATLRRAVDGLLLPHAAKYSEMCLLGVR 480
gi 71756025 400 EELQEMVDFLVDYSYDELKKHELMCRQVSLKIRWNSYRHQQYTKNLTQYSDDSATLRRAVDELMLPHAAKYSEMRLLGVR 479
gi 71756027 401 EGMQEMLDTVFNGAYEEMRKSEIMCRRISLTIRWASYRYQQYTKSLIQHSDDSATLRRAVDGLLLPHAAKYSEMCLLGVR 480
gi 71756033 400 EQLHEMIYSIFEEAYEEMRQNEMLCRQISLLVRWSSYRYQQYTKSLIQYSDDSATLRRAVDGLLLPHAAKYSEMCLLGVR 479
gi 71756035 401 EGMQEMVDTVFNGAYEEMRKSEIMCRRISLTIRWASYRYQQYTKSLIQYSDDSATLRRAVDELMLPHAAKYSEMCLLGVR 480
gi 71756037 401 EGMQEMVDTVFNGAYEEMRKSELMCRRISLRIRWASYRYQQYTKSLIQYSDDSATLRRAVDGLLLPHAAKYSEISLLGVR 480
                       490       500       510       520       530       540       550       560
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71756021 481 LSDLISAKDFHMKRKGGNQLSISQFIRPKKPGEVTATTGIKRERTTEPKQVVEIIISSDDEDENDSVGLASSSTILVSTD 560
gi 71756019 480 LLDLIFAKDFHMKRKGGNQLSISQFIRPKKPGEVTATTGIKRERTTEPKQVVEIIISSDDEDENDSVGLASSSTILVSTG 559
gi 71756023 481 FLDLISAKDFHMKRKGGNQLSISQFIRPKKPGEVTATTGIKRERTTEPKQVVEIIISSDDEDENDSVGLASSSTILVSTD 560
gi 71756025 480 FLDLIFAKDFHMKKKGGNQLSISQFIRPKKPGEVTATTGIKRERTTEPKQVVEIIISSDDEDENDSVGLASSSTVLVSTD 559
gi 71756027 481 LSDLISAKDFHMKRKGGNQLSISQFIRPKKPGEVTATTGIKRERTTEPKQVVEIIISSDDEDENDSVGLASSSTILVSTG 560
gi 71756033 480 FLDLISAKDFHMKRKGGNQLSISQFIRPKKPGEVTATTGIKRERTTEPKQVVEIIISSDDEDENDSVGLASSSTILVSTD 559
gi 71756035 481 LSDLISAKDFHMKRKGGNQLSISQFIRPKKPGEVTATTGIKRERTTEPKQVVEIIISSDDEDENDSVGLASSSTILVSTG 560
gi 71756037 481 FLDLIFAKDFHMKRKGGNQLSISQFIRPKKPGEVTATTGIKRERTTEPKQVVEIIISSDDEDENDSVGLASSSTILVSTD 560
                       570
                ....*....|.
gi 71756021 561 KGTVEREVTII 571
gi 71756019 560 KGTVEREVTII 570
gi 71756023 561 KGTVEREVTII 571
gi 71756025 560 KGTVEREVTII 570
gi 71756027 561 KGTVEREVTII 571
gi 71756033 560 KGTVEREVTII 570
gi 71756035 561 KGTVEREVTII 571
gi 71756037 561 KGTVEREVTII 571
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap