Conserved Protein Domain Family
PTZ00210

?
PTZ00210: PTZ00210 
UDP-GlcNAc-dependent glycosyltransferase; Provisional
Statistics
?
PSSM-Id: 140237
View PSSM: PTZ00210
Aligned: 8 rows
Threshold Bit Score: 715.131
Threshold Setting Gi: 72393489
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72388496   1 MSPLKMRPTQARRRPRTADIAVILLLVMSLLIICCNLHRIHVVSTFLDENQAGVSQPIDEDEYLMFVPSNVAAVWKAQRF 80
gi 72388498   1 MSPLKMRPTQARRRPRTADIAVILLLVMSLLIICCNLHRIHVVSTFLDENQAGVSQPIDEDEYLMFVPSNVAAVWKAQRF 80
gi 72388500   1 MSPLKMRPTQARRRPRTADIAVILLLVMSLLIICCNLHRIHEVSTFLDENQAGVSQPIDEGEYLMFVPSNVAAVWKAQRF 80
gi 72388502   1 MSPLKMRPTQARRRPRTADIAVILLLVMSLLIICCNLHRIHEVSTFLDENQAGVSQPIDEGEYLMFVPSNVAAVWKAQRF 80
gi 72388504   1 MSPLKMRPTQARRRPRTADIAVILLLVMSLLIICCNLHRIHVVSTFLDENQAGVSQPIDEDEYLMFVPSNVAAVWKAQRF 80
gi 72388506   1 MSPLKMRPTQARRRPRTADIAVILLLVMSLLIICCNLHRIHVVSTFLDENQAGVSQPIDEDEYLMFVPSNVAAVWKAQRF 80
gi 72393487   1 -------MRTRRRRSQVYAFTLAVLIAISCLVVCCDLFFLSVIHLPLEEEKASA--PINVDECLRLTAPSTVSIWQEREF 71
gi 72393489   1 MTQRKVYPPYSWRKPRASVLVLTTTFTMALIIIMWDIYHISEVHSNSSYDLLGT---FENDYYLTLTPPSTVSIWQEREF 77
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72388496  81 LAVLGIPSVDNSERSRRRDLQRQTCWKYSGVATRSNNFSGSLLPLYLLAPHQSNSYLISHSLKEEAARTHDIITLPTNDV 160
gi 72388498  81 LAVLGIPSVDNSERSRRRDLQRQTCWKYSGVATRSNNFSGSLLPLYLLAPHQSNSYLISHSLKEEAARTHDIITLPTNDV 160
gi 72388500  81 LAVLGIPSVDNSERSRRRDLQRQTCWKYSGVATRSNNFSGSLLPLCLLAPHQSNSYLISHSLKEEAARTHDIITLPTNDV 160
gi 72388502  81 LAVLGIPSVDNSERSRRRDLQRQTCWKYSGVATRSNNFSGSLLPLCLLAPHQSNSYLISHSLKEEAARTHDIITLPTNDV 160
gi 72388504  81 LAVLGIPSVDNSERSRRRDLQRQTCWKYSGVATRSNNFSGSLLPLYLLAPHQSNSYLISHSLKEEAARTHDIITLPTNDV 160
gi 72388506  81 LAVLGIPSVDNSERSRRRDLQRQTCWKYSGVATRSNNFSGSLLPLYLLAPHQSNSYLISHSLKEEAARTHDIITLPTNDV 160
gi 72393487  72 LVIVGIPSVDRDEWQKRRNLQRRTCWQYAGVATLENNFTGELLPLYLLAPHQLNGYEISESLRDEASRTNDVVMLPTNDV 151
gi 72393489  78 LVIVGIPSVDRDEWQKRRNLQRRTCWQYAGVATLENNFTGELLPLYLLAPHQLNGYEISESLRDEASRTNDVVMLPTNDV 157
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72388496 161 SPSTRKKIGENGNWGIEAEVAMSRKTYLWLRFALHMFPNVSYIVKGDDDIFIRVPKYLADLRVMPRHGLYMGRYNYYNRI 240
gi 72388498 161 SPSTRKKIGENGNWGIEAEVAMSRKTYLWLRFALHMFPNVSYIVKGDDDIFIRVPKYLADLRVMPRHGLYMGRYNYYNRI 240
gi 72388500 161 SPSTRKKIGENGNWGIEAEVAMSRKTYLWLRFALHMFPNVSYIVKGDDDIFIRVPKYLADLRVMPRHGLYMGRYNYYNRI 240
gi 72388502 161 SPSTRKKIGENGNWGIEAEVAMSRKTYLWLRFALHMFPNVSYIVKGDDDIFIRVPKYLADLRVMPRHGLYMGRYNYYNRI 240
gi 72388504 161 SPSTRKKIGENGNWGIEAEVAMSRKTYLWLRFALYMFPNVSYIVKGDDDIFIRVPKYLADLRVMPRHGLYMGRYNYYNRI 240
gi 72388506 161 SPSTRKKIGENGNWGIEAEVAMSRKTYLWLRFALHMFPNVSYIVKGDDDIFIRVPKYLADLRVMPRHGLYMGRYNYYNRI 240
gi 72393487 152 CSFSRRKIGEGGSWGVESELVMSRKTFLWLQFAVTAFPNVSYIVKGDDDVFVRVPQYLADLRVMPRNGLYMGRVYGATFF 231
gi 72393489 158 CSLARRKIGEGGSWGVESELVMSRKTFLWLQFAVTAFPNVSYIVKGDDDVFVRVPQYLADLRVMPRNGLYMGRVYGATFF 237
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72388496 241 WRRNQLTYVNGYCITLSRDTAQAIISYKPLERLVNMPFSMWDYFDFLDLGMFYEDVMVGMILREKVVYRNLISVDTKACR 320
gi 72388498 241 WRRNQLTYVNGYCITLSRDTAQAIISYKPLERLVNMPFSMWDYFDFLDLGMFYEDVMVGMILREKVVYRNLISVEMGRCH 320
gi 72388500 241 WRRNQLTYVNGYCITLSRDTAQAIISYKPLERLVNMPFSMWDYFDFLDLGMFYEDVMVGMILREKVVYRNLISVEMGRCH 320
gi 72388502 241 WRRNQLTYVNGYCITLSRDTAQAIISYKPLERLVNMPFSMWDYFDFLDLGMFYEDVMVGMILREKVVYRNLISVEMGRCH 320
gi 72388504 241 WRRNQLTYVNGYCITLSRDTAQAIISYKPLERLVNMPFSMWDYFDFLDLGMFYEDVMVGMILREKVVYRNLISVEMGRCH 320
gi 72388506 241 WRRNQLTYVNGYCITLSRDTAQAIISYKPLERLVNMPFSMWDYFDFLDLGMFYEDVMVGMILREKVVYRNLISVEMGRCH 320
gi 72393487 232 WRSGGIPFAAGYFTTFSRDVAEAVASYRPLERLLKAPYSIWRMRQYLSMSVLHEDVMTALVLQDKIRYKGLIIVDAAPCH 311
gi 72393489 238 WRSGGIPFAAGYFTTFSRDVAEAVASYRPLERLLKAPYSIWRMRQYLSMSVLHEDVMSALVLQDKIRYKGLIIANAAGCH 317
                       330       340       350       360       370       380
                ....*....|....*....|....*....|....*....|....*....|....*....|..
gi 72388496 321 FHNAGPGSVRKYISNKSVVIHHVSEEHYNELFDIFPVGEGGDKPSAVRWLYPGSGTLPCFQH 382
gi 72388498 321 FHNAGKFGVKKSVRNMSVVIHHIQEADYEMLMDYFPEGVIPPAPSKLMWLNSNWAAMQCEFR 382
gi 72388500 321 FHNAGKFGVKKSVRNMSVVIHHIQEADYEMLMDYFPEGVIPPAPSKLMWLNSNWAAMQCEFR 382
gi 72388502 321 FHNAGKFGVKKSVRNMSVVIHHIQEADYEMLMDYFPEGVIPPAPSKLMWLNSNWAAMQCEFR 382
gi 72388504 321 FHNAGKFGVKKSVRNMSVVIHHIQEADYEMLMDYFPEGVIPPAPSKLMWLNSNWAAMQCEFR 382
gi 72388506 321 FHNAGKFGVKKSVRNMSVVIHHIQEADYEMLMDYFPEGVIPPAPSKLMWLNSNWAAMQCEFR 382
gi 72393487 312 FHNAGKKGIRASLIDEYVVVHHIKENDYEVLMNHFADIAVQPKPSKVMWRSENYAVMQCFAT 373
gi 72393489 318 FHNKAKEDIREAVSNRSVVVHHIREEDYEVLMDHFSNISERPQPYGVRWLRNDRAMVLC--- 376
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap