Conserved Protein Domain Family
PTZ00221

?
PTZ00221: PTZ00221 
cyclophilin; Provisional
Statistics
?
PSSM-Id: 140248
View PSSM: PTZ00221
Aligned: 10 rows
Threshold Bit Score: 393.851
Threshold Setting Gi: 72389923
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71418924   12 LRKEKVEHSNVRADTEDDVSPLNKRYQDVEERRLKEWENYQRSHRSTEEQQSSRAFLDISIGDVLAGRLVLELFEDTVPN 91
gi 71656129   12 LRKEKVEHSNVRADTEDDVSPLNKRYQDVEERRLKEWENYQRSHRSTEEQQSSRAFLDISIGDVLAGRLVLELFEDTVPN 91
gi 72389935   12 SRRKKGDSRLQRPENDEDSATLQSRYDDVEERRLKEWENYQRSHRMKEEQNSCRAFLDMSIDDVLSGRLVFELFDDVVPR 91
gi 72389931    1 ---------------------------------------------MKEEQNSCRAFLDMSIDDVLSGRLVFELFDDVVPQ 35
gi 72389927    1 ---------------------------------------------MKEEQNSCRAFLDMSIDDVLSGRLVFELFDDVVPQ 35
gi 72389923    1 ---------------------------------------------MKEEQNSCRAFLDMSIDDVLSGRLVFELFDDVVPQ 35
gi 72389919    1 ---------------------------------------------MKEEQNSCRAFLDMSIDDVLSGRLVFELFDDVVPQ 35
gi 146093410   1 MPFRVLKPRRDAPQALLTPPSREQVYNNIEERRLKEWENYQKAHRFMEEAHTNRIFLDIGIGDALAGRLVVELFEDVVPE 80
gi 154341371   1 MPLRALKARKDAPQVLPPMPSREQVYNDIEQRRLKEWENYQKSHRFMEEAHTNRIFLDIGIGDALAGRLVVELFEDVVPE 80
gi 157872085   1 MPFRVLKPRRDAPQALPTPPSREQVYNNIEERRLKEWENYQKAHRFMEEAHTNRIFLDIGIGDALAGRLVVELFEDVVPE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71418924   92 TVLNFRSLITGSCGVDPVTGVRLDYLYTPVHRVDRARKLILLGELESLNVSSTGTPIQDEGYGKCHSERGLLTMVSDGPH 171
gi 71656129   92 TVLNFRSLITGSCGVDPVTGVRLDYLYTPVHRVDRARKLILLGELESLNVSSTGTPIQDEGYGKCHSERGLLTMVSDGPH 171
gi 72389935   92 TVENFRALITGSCGIDTNTGVKLDYLGTQVHHVDHNNNIIVLGELDSFNLSSTGTPIADEGYRHRHTERGLLTMISEGPH 171
gi 72389931   36 TVENFRALITGSCGIDTNTGVKLDYLGTQVHHVDHNNNIIVLGELDSFNLSSTGTPIADEGYRHRHTERGLLTMISEGPH 115
gi 72389927   36 TVENFRALITGSCGIDTNTGVKLDYLGTQVHHVDHNNNIIVLGELDSFNLSSTGTPIADEGYRHRHTERGLLTMISEGPH 115
gi 72389923   36 TVENFRALITGSCGIDTNTGVKLDYLGTQVHHVDHNNNIIVLGELDSFNLSSTGTPIADEGYRHRHTERGLLTMISEGPH 115
gi 72389919   36 TVENFRALITGSCGIDTNTGVKLDYLGTQVHHVDHNNNIIVLGELDSFNLSSTGTPIADEGYRHRHTERGLLTMISEGPH 115
gi 146093410  81 TAARFHRLVTGEGGIHDATGVKLDYLYTPLELIDRQHGYARFGDLLAYGVRL--EPLRQETFKVRHTSRGLLTMTSYGPN 158
gi 154341371  81 TAAHFRRLVTGESGTHDATGVKLDYLHTSLELIDRKHGYVRFGDLLAYGVRL--EPLRQETFKVRHTSRGLLTMTSYGPH 158
gi 157872085  81 TAARFHRLVTGEGGIHDATGVKLDYLYTPLELIDRQHGYARFGDLLAYGVRL--EPLRQETFKVRHTSRGLLTMTSYGPN 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71418924  172 TSGSVFGITLGPSRSLDFKQVVFGKAVDDLTLLEKLESLPLDAVGHPLVAAVVTFCGALTGPKPSGRFVCTREVNGNTAG 251
gi 71656129  172 TSGSVFGITLGPSRSLDFKQVVFGKAVDDLTLLEKLESLPLDAVGHPIVPAVVTFCGALTGPKPSGKFVCTREVDGNTVG 251
gi 72389935  172 TSGSVFGITLGPSPSLDFKQVVFGRAIDDLSLLEKLEAVPLDDVGRPVLPVTVSFCGALTGEKPPGRQQVPAAADDSASS 251
gi 72389931  116 TSGSVFGITLGPSPSLDFKQVVFGRAIDDLSLLEKLEAVPLDDVGRPVLPVTVSFCGALTGEKPPGRQQLLAAADDSASS 195
gi 72389927  116 TSGSVFGITLGPSPSLDFKQVVFGRAIDDLSLLEKLEAVPLDDVGRPVLPVTVSFCGALTGEKPPGRQQLLAAADDSASS 195
gi 72389923  116 TSGSVFGITLGPSPSLDFKQVVFGRAIDDLSLLEKLEAVPLDDVDRPVLPVTVSFCGALTGEKPPGRQQVPAAADDSASS 195
gi 72389919  116 TSGSVFGITLGPSPSLDFKQVVFGRAIDDLSLLEKLEAVPLDDVGRPVLPVTVSFCGALTGEKPPGRQQLLAAADDSASS 195
gi 146093410 159 LCNTSFAITLAAAPSLDFKQVAFGKVVDGLHLLEKLESLPLDQVGRPLTPVMIAICGTLTGERPPGKWA--SPQDRTGCD 236
gi 154341371 159 LCNTSFSITLAAAPSLDFKQVVFGKVVDGLPLLEKLESLPLDQVGRPLTPVMIALCGTLTGGRPPGKWA--SSQDRTACK 236
gi 157872085 159 LCNTSFSITLAAAPSLDFKQVAFGKVVDGLHLLEKLESLPLDQVGRPLTPVMIAICGTLTGERPPGKWA--SPQDRTGCD 236

                 ....*....
gi 71418924  252 DGAAAAAEE 260
gi 71656129  252 DGAAAAAAE 260
gi 72389935  252 EHVSCAGEE 260
gi 72389931  196 EHVSCAGEE 204
gi 72389927  196 EHVSCAGEE 204
gi 72389923  196 EHVSCAGEE 204
gi 72389919  196 EHVSCAGEE 204
gi 146093410 237 EDLAYEAIQ 245
gi 154341371 237 EDLAYEALE 245
gi 157872085 237 EDLAYEAIE 245
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap