Conserved Protein Domain Family
PTZ00222

?
PTZ00222: PTZ00222 
60S ribosomal protein L7a; Provisional
Statistics
?
PSSM-Id: 140249
View PSSM: PTZ00222
Aligned: 10 rows
Threshold Bit Score: 438.363
Threshold Setting Gi: 71414791
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71659118    1 MPGKEVKKAAKPaaktaaktaakpaaksaakpaakpaakpaakpaakpaaktaakpakkpavkptvkpaAKAAAPYKKP- 79
gi 71414791    1 MPGKEVKKAAKPapktaakpaakpaakpaaktaakpvak----taakpvaktaakpakkptvkpavkpaAKAAAPYKKP- 75
gi 72392337    1 MAGKEVKKAVKPt--------------------------------------------------------KKAGVPYKKPe 24
gi 72392339    1 MAGKEVKKAVKPt--------------------------------------------------------KKAGVPYKKPe 24
gi 154332356   1 MPGKEAKRATQP---------------------------------------------------------VKAASPYKKP- 22
gi 154332358   1 MPGKEAKRATQP---------------------------------------------------------VKAASPYKKP- 22
gi 146077433  70 MPGKEVKKATQP---------------------------------------------------------AKAASPYKKP- 91
gi 146077437  85 MPGKEVKKATQP---------------------------------------------------------AKAASPYKKP- 106
gi 157864492   1 MPGKEVKKVTQP---------------------------------------------------------AKAASPYKKP- 22
gi 157864494   1 MPGKEVKKVTQP---------------------------------------------------------AKAASPYKKP- 22
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71659118   80 ----------AAISPFVARPKNFGIGHDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALHQFTKVLDRSSRNELL 149
gi 71414791   76 ----------AATSSFVARPKNFGIGHDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALHQFTKVLDRSSRNELL 145
gi 72392337   25 vtqkkakasaAAPSPFVARPKDFGIGRDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRSSRNELL 104
gi 72392339   25 vtqkkakasaAAPSPFVARPKDFGIGRDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRSSRNELL 104
gi 154332356  23 ----------AAASRFTARPKNFGIGQDVPYSRDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRTSRNEVL 92
gi 154332358  23 ----------AAASRFTARPKNFGIGQDVPYSRDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRTSRNEVL 92
gi 146077433  92 ----------AVASHFAARPKNFGIGQDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRASRNEAL 161
gi 146077437 107 ----------AVASHFAARPKNFGIGQDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRASRNEAL 176
gi 157864492  23 ----------AVASHFAARPKNFGIGQDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRASRNEAL 92
gi 157864494  23 ----------AVASHFAARPKNFGIGQDVPYARDLSRFMRWPTFVTMQRKKRVLQRRLKVPPALNQFTKVLDRASRNEAL 92
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71659118  150 KLVKKYPSETRRARRQRLFDVATEKKKNPE-AASKKAPLSVVTGLQEVTRTIEKKTARLVMIANNVDPIELVLWMPTLCR 228
gi 71414791  146 KLVKKYPSETRRARRQRLFDVATEKKKNPE-AASKKAPLSVVTGLQEVTRTIEKKTARLVMIANNVDPIELVLWMPTLCR 224
gi 72392337  105 KLVKKYAPETRKARRDRLTKVAEEKKKNPKgTVSTKAPLCVVSGLQEVTRTIEKKTARLVLIANNVDPIELVLWMPTLCR 184
gi 72392339  105 KLVKKYAPETRKARRDRLTKVAEEKKKNPKgTVSTKAPLCVVSGLQEVTRTIEKKTARLVLIANNVDPIELVLWMPTLCR 184
gi 154332356  93 RLIKKYAPETRKARRDRLHKAAEEKKKDPRkTVSTRAPLAVVTGLQEVTRAIEKKQARMVVIANNVDPVELVLWMPNLCR 172
gi 154332358  93 RLIKKYAPETRKARRDRLHKAAEEKKKDPRkTVSTRAPLAVVTGLQEVTRAIEKKQARMVVIANNVDPVELVLWMPNLCR 172
gi 146077433 162 KLIKKYAPETRKARRERLHKAAEEKKKDPKkTVSTRAPLAVVTGLQEVTRAIEKKQARMVVIANNVDPVELVLWMPNLCR 241
gi 146077437 177 KLIKKYAPETRKARRERLHKAAEEKKKDPKkTVSTRAPLAVVTGLQEVTRAIEKKQARMVVIANNVDPVELVLWMPNLCR 256
gi 157864492  93 KLIKKYAPETRKARRERLQKVAEEKKKDPKkTVSTKAPLAVVTGLQEVTRAIEKKQARMVVIANNVDPVELVLWMPNLCR 172
gi 157864494  93 KLIKKYAPETRKARRERLQKVAEEKKKDPKkTVSTKAPLAVVTGLQEVTRAIEKKQARMVVIANNVDPVELVLWMPNLCR 172
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71659118  229 ANKVPYAIVKDKARLGDAVGRKTATCVAITDVNAEDEAALKNLIRSVNARFLARSDVIRRQWGGLQLSLRSRAELRKKRA 308
gi 71414791  225 ANKVPYAIVKDKARLGDAVGQKTATCVAITDVNAEDEAALKNLIRSVNARFLARSDVIRRQWGGLQLSLRSRAELRKKRA 304
gi 72392337  185 ANKIPYAIVKDKARLGDAIGRKTATCVAFTDVNAEDQAALKNLTRSVNARFLARSDVIRRQWGGLQLSLRSRAELRKKRA 264
gi 72392339  185 ANKIPYAIVKDKARLGDAIGRKTATCVAFTDVNAEDQAALKNLTRSVNARFLARSDVIRRQWGGLQLSLRSRAELRKKRA 264
gi 154332356 173 ANNIPYAIVKDMARLGDAIGRKTATCVAITDVNAEEEAALKNLIRSVNARFLSRSDVIRRQWGGLQLSLRSRAELRKKHA 252
gi 154332358 173 ANNIPYAIVKDMARLGDAIGRKTATCVAITDVNAEEEAALKNLIRSVNARFLSRSDVIRRQWGGLQLSLRSRAELRKKHA 252
gi 146077433 242 ANKIPYAIVKDMARLGDAIGRKTATCVAITDVNAEDEATLKNLIRSVNARFLSRSDVIRRQWGGLQLSLRSRAELRKKHA 321
gi 146077437 257 ANKIPYAIVKDMARLGDAIGRKTATCVAITDVNAEDEATLKNLIRSVNARFLSRSDVIRRQWGGLQLSLRSRAELRKKHA 336
gi 157864492 173 ANKIPYAIVKDMARLGDAIGRKTATCVALTDVNAEDEATLKNLIRSVNARFLSRSDVIRRQWGGLQLSLRSRAELRKKHA 252
gi 157864494 173 ANKIPYAIVKDMARLGDAIGRKTATCVALTDVNAEDEATLKNLIRSVNARFLSRSDVIRRQWGGLQLSLRSRAELRKKHA 252
                        330
                 ....*....|.
gi 71659118  309 RNAGKDAAAVM 319
gi 71414791  305 RNAGKDAAAVM 315
gi 72392337  265 RTAGNDAAAKA 275
gi 72392339  265 RTAGNDAAAKA 275
gi 154332356 253 RNAGVDAAAVV 263
gi 154332358 253 RNAGVDAAAVV 263
gi 146077433 322 RNAGVDAAAII 332
gi 146077437 337 RNAGVDAAAII 347
gi 157864492 253 RNAGVDAAAII 263
gi 157864494 253 RNAGVDAAAII 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap