Conserved Protein Domain Family
PTZ00223

?
PTZ00223: PTZ00223 
40S ribosomal protein S4; Provisional
Statistics
?
PSSM-Id: 140250
View PSSM: PTZ00223
Aligned: 10 rows
Threshold Bit Score: 528.415
Threshold Setting Gi: 157866320
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71653417    1 MTKKHLKRLYAPKDWMLSKLTGVFAPRPRAGPHKLRECMTLMIIIRNRLKYALNAAEAQMILRQGLVCVDGKPRKDTKYP 80
gi 71415246    1 MTKKHLKRLYAPKDWMLSKLTGVFAPRPRAGPHKLRECMTLMIIIRNRLKYALNAAEAQMILRQGLVCVDGKPRKDTKYP 80
gi 71415254    1 MTKKHLKRLYAPKDWMLSKLTGVFAPRPRAGPHKLRECMTLMIIIRNRLKYALNAAEAQMILRQGLVCVDGKPRKDTKYP 80
gi 71755051    1 MAKKHLKRLYAPKDWMLSKLTGVFAPRPRAGPHKLRECLSLLIIIRNRLKYALNALEAQMILRQGLVCVDGKPRKDGKYP 80
gi 71755053    1 MAKKHLKRLYAPKDWMLSKLTGVFAPRPRAGPHKLRECLSLLIIIRNRLKYALNALEAQMILRQGLVCVDGKPRKDGKYP 80
gi 146080974   1 MAKKHLKRLYAPKDWMLSKLTGVFAPRPRPGPHKLRECLPLLVIIRNRLKYALNAREGEMILRQGLVHVDNHPRRDGKYP 80
gi 146080976 208 MAKKHLKRLYAPKDWMLSKLTGVFAPRPRPGPHKLRECLPLLVIIRNRLKYALNAREGEMILRQGLVHVDNHPRRDGKYP 287
gi 154333974   1 MAKKHLKRLYAPKDWMLSKLTGVFAPRPRPGPHKLRECLPLLVIIRNRLKYALNAREGEMILRQGLVHVDNHPRRDGKYP 80
gi 157866320   1 MAKKHLKRLYAPKDWMLSKLTGVFAPRPRPGPHKLRECLPLLVIIRNRLKYALNAREGEMILRQGLVHVDNHPRRDGKYP 80
gi 157866322   1 MAKKHLKRLYAPKDWMLSKLTGVFAPRPRPGPHKLRECLPLLVIIRNRLKYALNAREGEMILRQGLVHVDNHPRRDGKYP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71653417   81 VGFMDVVEIPRTGDRFRILYDVKGRFALVKVGEAEGNIKLLKVENVYTSTGRIPVAMTHDGHRIRYPDPRTHRGDTLVYN 160
gi 71415246   81 VGFMDVVEIPRTGDRFRILYDVKGRFALVKVGEAEGNIKLLKVENVYTSTGRIPVAMTHDGHRIRYPDPRTHRGDTLVYN 160
gi 71415254   81 VGFMDVVEIPRTGDRFRILYDVKGRFALVKVGEAEGNIKLLKVENVYTSTGRIPVAMTHDGHRIRYPDPRTHRGDTLVYN 160
gi 71755051   81 AGFMDVVEIPKTGDRFRILYDVKGRFALVRVSEAESSIKMMKVVNVYTGTGRIPVAVTHDGHRIRYPDPRTSRGDTLVYD 160
gi 71755053   81 AGFMDVVEIPKTGDRFRILYDVKGRFALVRVSEAESSIKMMKVVNVYTGTGRIPVAVTHDGHRIRYPDPRTSRGDTLVYD 160
gi 146080974  81 AGFMDVVEIPKTGDRFRLMYDVKGRFALVSLSEAEAQIKLMKVVNLYTATGRVPVAVTHDGHRIRYPDPHTSIGDTIVYN 160
gi 146080976 288 AGFMDVVEIPKTGDRFRLMYDVKGRFALVSLSEAEAQIKLMKVVNLYTATGRVPVAVTHDGHRIRYPDPHTSIGDTIVYN 367
gi 154333974  81 AGFMDVIEIPKTGDRFRLLYDVKGRFALVSVSEAEAQIKLMKVVNLYTATGRVPVAVTHDGHRIRYPDPHCSIGDTIVYN 160
gi 157866320  81 AGFMDVVEIPKTGDRFRLMYDVKGRFALVNLSEAEAQIKLMKVVNLYTATGRVPVAVTHDGHRIRYPDPHTSIGDTIVYN 160
gi 157866322  81 AGFMDVVEIPKTGDRFRLMYDVKGRFALVNLSEAEAQIKLMKVVNLYTATGRVPVAVTHDGHRIRYPDPHTSIGDTIVYN 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71653417  161 LKEKKVVDLIKSSNGKVVMVTGGANRGRIGEIMSIERHPGAFDIARLKDAAGHEFATRASNIFVIGKDMQSVPVTLPKQQ 240
gi 71415246  161 LKEKKVVDLIKSSNGKVVMVTGGANRGRIGEIMSIERHPGAFDIARLKDAAGHEFATRASNIFVIGKDMQSVPVTLPKQQ 240
gi 71415254  161 LKEKKVVDLIKSSNGKVVMVTGGANRGRIGEIMSIERHPGAFDIARLKDAAGHEFATRASNIFVIGKDMQSVPVTLPKQQ 240
gi 71755051  161 VKEKKVLDLIKIGNGKVVMVTGGANRGRIGEIVSIERHPGAFDIARLKDASGHEFATRATNIFVIGKDMSSVPVTLPKQQ 240
gi 71755053  161 VKEKKVLDLIKIGNGKVVMVTGGANRGRIGEIVSIERHPGAFDIARLKDASGHEFATRATNIFVIGKDMSSVPVTLPKQQ 240
gi 146080974 161 VKEKKCVDLIKNRQGKAVIVTGGANRGRIGEIVKVECHPGAFNIAHLKDASGAEFATRAANIFVIGKDLNHLQVTVPKQQ 240
gi 146080976 368 VKEKKCVDLIKNRQGKAVIVTGGANRGRIGEIVKVECHPGAFNIAHLKDASGAEFATRAANIFVIGKDLNHLQVTVPKQQ 447
gi 154333974 161 VNEKKCVDLIKNRQGKAVIVTGGANRGRIGEIVKVERHPGAFDIAHLKDASGAEFATRAANIFVIGKDLNNLQVTVPKQQ 240
gi 157866320 161 VKEKKCVDLIKNRQGKAVIVTGGANRGRIGEIVKVECHPGAFNIAHLKDASGAEFATRAANIFVIGKDLNNLQVTVPKQQ 240
gi 157866322 161 VKEKKCVDLIKNRQGKAVIVTGGANRGRIGEIVKVECHPGAFNIAHLKDASGAEFATRAANIFVIGKDLNNLQVTVPKQQ 240
                        250       260       270
                 ....*....|....*....|....*....|...
gi 71653417  241 GLRINVIQEREEKLIAAEARKNMQTRGVRKARK 273
gi 71415246  241 GLRINVIQEREEKLIAAEARKNMQTRGVRKARK 273
gi 71415254  241 GLRINVIQEREEKLIAAEARKNMQTRGVRKARK 273
gi 71755051  241 GLRINVIQEREEKLIAAETRRTTQAHSKRKTKV 273
gi 71755053  241 GLRINVIQEREEKLIAAETRRTTQAHSKRKTKV 273
gi 146080974 241 GLRMNVIQEREERLIAAEARKNAPARGARKARK 273
gi 146080976 448 GLRMNVIQEREERLIAAEARKNAPARGARKARK 480
gi 154333974 241 GLRMNVIQEREERLIAAEARKTAPARGARKARK 273
gi 157866320 241 GLRMNVIQEREERLIAAEARKNAPARGARRARK 273
gi 157866322 241 GLRMNVIQEREERLIAAEARKNAPARGARRARK 273
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap