Conserved Protein Domain Family
PTZ00225

?
PTZ00225: PTZ00225 
60S ribosomal protein L10a; Provisional
Statistics
?
PSSM-Id: 140252
View PSSM: PTZ00225
Aligned: 10 rows
Threshold Bit Score: 368.605
Threshold Setting Gi: 71748990
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71660333    1 MSKIPPAQLSEAIQAVLTNRKERKFKESIDLQVNLKNYDPQKDKRFSGSVRLPHVCRPRMTVCLLCDLVHEDIAKKNNVP 80
gi 71420692    1 MSKIPPAQLSEAIQAVLTNRKERKFKESIDLQVNLKNYDPQKDKRFSGSVRLPHVCRPRMTVCLLCDLVHEDIAKKNNVP 80
gi 71748990    1 MSKIPPALLSEAIQNVLKDRKERKFKESIDLQVNLKNYDPQKDKRFSGSVRLPHVCRPRMTVCLLCDLVHEDIAKKNDVP 80
gi 74024938    1 MSKIPPALLSEAIQNVLKDRKERKFKESIDLQVNLKNYDPQKDKRFSGSVRLPHVCRPRMTVCLLCDLVHEDIAKKNDVP 80
gi 146103761   1 MSKIAPQTLVEAIQAVLKVDKERKFKESVDLQVNLKNYDPQKDKRFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVP 80
gi 146083933   1 MSKIAPQTLVEAIQAVLKVDKERKFKESVDLQVNLKNYDPQKDKRFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVP 80
gi 154335511   1 MSKISPQTLSEAIQAVLKVDKERKFKESIDLQVNLKNYDPQKDKRFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVP 80
gi 157867831   1 MSKIAPQTLMEAIQAVLKVDKERKFKESVDLQVNLKNYDPQKDKRFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVP 80
gi 157877260   1 MSKIAPQTLMEAIQAVLKVDKERKFKESVDLQVNLKNYDPQKDKRFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVP 80
gi 154346164   1 MSKISPQALSEAIQAVLKVDKERKFKESIDLQVNLKNYDPQKDKRFSGSLKLPNVCRPRMTVCLLCDLVHEDIAKKEGVP 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71660333   81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRVGKFPTVCAMSESLPEKVLEIQSTVKFQLKKVL 160
gi 71420692   81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRVGKFPTVCAMSESLPEKVLEIQSTVKFQLKKVL 160
gi 71748990   81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRVGKFPTVCAQNESLPDKVLELQSTVKFQLKKVL 160
gi 74024938   81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRVGKFPTVCAQNESLPDKVLELQSTVKFQLKKVL 160
gi 146103761  81 TMNQEDLKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLTDKIVELRSTVKFQLKKVL 160
gi 146083933  81 TMNQEDLKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLTDKIVELRSTVKFQLKKVL 160
gi 154335511  81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLTEKVVELRSTVKFQLKKVL 160
gi 157867831  81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLADKIVELRSTVKFQLKKVL 160
gi 157877260  81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLADKIVELRSTVKFQLKKVL 160
gi 154346164  81 TMNQEELKKLNKNKKLVKKMCNQYDAFLCSESIIKTVPRLVGPHMHRMGKFPTVCSPSESLTEKVVELRSTVKFQLKKVL 160
                        170       180       190       200       210
                 ....*....|....*....|....*....|....*....|....*....|....
gi 71660333  161 CLGTCVGHVEMTEDQVRQNTVMAINFLVSLLKKNWQNLKSAYIKSTMGKPQRIY 214
gi 71420692  161 CLGTCVGHVEMTEDQVRQNTVMAVNFLVSLLKENWQNLKSAYIKSTMGNRSAFT 214
gi 71748990  161 CLGTCVGHVDMTEDQVRQNVVMAINFLVSLLKKNWQNLKSAYIKSTMGKSQRIY 214
gi 74024938  161 CLGTCVGHVDMTEDQVRQNVVMAINFLVSLLKKNWQNLKSAYIKSTMGKSQRIY 214
gi 146103761 161 CLGTCVGHMEMSEEQLRQNVTMAINFLVSLLKKNWQNLKSAYIKSTMGKPQRIY 214
gi 146083933 161 CLGTCVGHMEMSEEQLRQNVTMAINFLVSLLKKNWQNLKSAYIKSTMGKPQRIY 214
gi 154335511 161 CLGTCIGHIEMNEEQLRQNVMMAINFLVSLLKKNWQNLKSAYIKSTMGRPQRIY 214
gi 157867831 161 CLGTCVGHMEMSEEQLRQNVTMAINFLVSLLKKNWQNLKSAYIKSTMGKPQRIY 214
gi 157877260 161 CLGTCVGHMEMSEEQLRQNVTMAINFLVSLLKKNWQNLKSAYIKSTMGKPQRIY 214
gi 154346164 161 CLGTCIGHIEMNEEQLRQNVMMAINFLVSLLKKNWQNLKSAYIKSTMGRPQRIY 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap