Conserved Protein Domain Family
PTZ00229

?
PTZ00229: PTZ00229 
variable surface protein Vir30; Provisional
Statistics
?
PSSM-Id: 140256
View PSSM: PTZ00229
Aligned: 3 rows
Threshold Bit Score: 468.251
Threshold Setting Gi: 156092580
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156092555  20 LFFHLIKFNKAKCrydffdNISNYMKDGKSIEDTVRSVDASKYCDSFSSATASqlGDKENAKYICEIFTKLCNHFPNCKK 99
gi 156092580   1 MIFHIHIMIKAKW------TAINYIESSNKLESNTTELDAQDNCTTFSNAYTS--SNFDTGKKVCELFIKLYNSLSNVEN 72
gi 156092559   1 -------MNIAQWiykffkDIDKYIAKAKDVESIDISDGLPSACTSFSRNWESklKINGTAENICVKCIKLYDSLDYINK 73
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156092555 100 -QEQNTSykQNCGLLNYWLNMKLNDDKINGKTCVLEIENTIQSQCSDIFEFNFDSlNFLYDIKKEELHKMNILYSLYQNY 178
gi 156092580  73 gNKPDDT--KDWHFLNYWLNINISKRKLNKSTCATKFSDGLSHHCTYTFSYEFPP-EFIYNIREEELIKMNLLYSLYENY 149
gi 156092559  74 tLPTDTNykKDCEFLNVWLNLKLYNNVINETDCVSMFYDELEAHCAGDCLGSLSDfQ-MYNIKNDDLDKMKILYNLHYKR 152
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156092555 179 SKLKNIIENKSGPEKTSLLPHSTACCADYNKAKYICSDDNNKitFCKKLVTFESKYDELYNTFKGKKSEFSDDLIKLSEC 258
gi 156092580 150 KKLDNILNGQKPVNAGSLLGPSAKCCSDYAEANYLCNDKNNE--FCTQLKKFKEKYDGLYNTEIEGKPEYTNNFIKLSQC 227
gi 156092559 153 SEIRDLIDTASNKDAKLLLEPSTLCFNEYRIAASKCNNKDSK--FCKLLENFKNEYEKLYPVVETKSPEFLKNFKRLSGD 230
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....
gi 156092555 259 TDNKiITTAVTGTVVGLIPLFGVLYKFTPMGQLLKSKIGILNNDISNNDEEYTKISLMEQESDHISSRQGTYNIKYQTL 337
gi 156092580 228 DNNT-MSKALIGTTVGLVPLLVGLYKFTPLRQLMNFKKGKLAEQYRNNDDEMRDIMLMDQGSEHISSQQGRYNIKYHSV 305
gi 156092559 231 ENNKiISTAVTGSIVGLIPLVGILYKYTPMGQLLKPNKGKVMDGQIYNGKDMRNISLMDQENEPSTFQQGTYNIKYQSA 309
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap