Conserved Protein Domain Family
PTZ00231

?
PTZ00231: PTZ00231 
variable surface protein Vir17; Provisional
Statistics
?
PSSM-Id: 140258
View PSSM: PTZ00231
Aligned: 5 rows
Threshold Bit Score: 640.01
Threshold Setting Gi: 156093008
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156092998   2 SYEEYTRLFELNKLIKKLDDTKYENCHELTLDFSRLVNETHKETLKNICCNLELGYTYLTARGGKTLTDLCKYLNLWLNK 81
gi 156093017  17 KLMSYINSSNLNMLISRLNDKRYENCYELTLNNFRSVNETDKEALKNIGCHLVSGYRFLYXFSGEKLVSLCKYLNFWLDE 96
gi 156093008   1 ------------MFIEQIKNFNYNNQTFCTIDDLTDIRAEENDALTNIGCTLYKGYRRLTAYDDENREIFCDYLNLWLDE 68
gi 156092882   1 --EVYEKTCPLNMFIAQIKNFKENSQRFSTSDYLTDIVTEKNEALTNIACSVYRGYTYLTPRDEEKRRNFCDYLNLWLDE 78
gi 156092664   1 MSYDYIKSFKLYMLINXMNNAKYKHSCAETQNYLHSIGQTNNETLKNIGCSLEYGYTFLTATRENTLTDLCTYLNLWLDE 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156092998  82 KKRTHV--NSGITEGEWQTVENLWITLMQR-QTTDHKCERKPEEKSISEYSKRLDLMSYCINRDYFKRLCQSPVGSDDYK 158
gi 156093017  97 QKSKHVirNSIVSEEEWEKVENLWTKLMQV-RAVDHQCKREHEEKDISDYSTRIELMSYCINRDYFKGXCQSPTGSVGFR 175
gi 156093008  69 KKSTHTtdKSDVIIEKWILIEKLWNKLYEI-EDPSRKCKRQEDGFDV-----------YCVNRDYFKDLCKKAIEKNSNV 136
gi 156092882  79 QKSIHMkdKNEISDHQWKYIEKIWERLSQGeRDRSPVCKRQKQEKNASEIKKRMNLMVYCVNRNYFKDLCEKSISRKNKV 158
gi 156092664  81 QKRIHVydKFKVSTNEWQVFEDLWNTLMEG-QTPDHKCERQHEENNISEYSKRLDLKSYCINRDYFKRLFQSSSRSDEYK 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156092998 159 AQKCKGFSDYTHDNYKKLIKDVKCIDKKSDNNDYKYYISDDCTLYDIPRTFPKCEAHSPTFVENDNSKTNI-MCETTEQV 237
gi 156093017 176 SQKCNSFSNYTSEYYVKLIKGIDCVDKNSEIMNYKYHISGDCTLYNIPKTFPKCDENTLTIVDVDNXKTDIkRCESTANV 255
gi 156093008 137 EKDCSLFSEFINKSYAEFFDENRCFDDPLDSDNYGYSISDDCDLSNIAKTFPKYDSTRQTILDNDNLKATIkRCVIPPKV 216
gi 156092882 159 NQTCSLFSEFTNKYYANFYDENKCFDYPLGTDNYGYYISEDCDLNNIAKTFPKFDSNSQTILENDNVRPTInKCGTPPDI 238
gi 156092664 160 AQICKGFSDYTQDNYNKLIEGMNCIDKKNGINDYNYHISDDCTLYNIPKTFPKCNEKTETIVDVDNSKKDIeKCESIKQV 239
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156092998 238 ESGGTESSENLAEHTERNGALDNhpdipDDPAKRPETPRGPVKLPEATGASEDLT----ELYLPSPTNVNSIDNGTSKSI 313
gi 156093017 256 GVGHNRLDSNNPGSVRLPAVLPYge--aGSLGVETALVDGEAPSSDDETISDDIPfdsmRLTPPSSTEVTLTDNGPSKPI 333
gi 156093008 217 EDGNSEPSVEVADVPPETSEPGK-----VLTESEDALTESKFRHPGQEVDLAVPP----VLFHPPSADANLTDNGHSKPI 287
gi 156092882 239 D-GNNEHTEDDADVLQEPSEPDN-----ALDESEDGLAESKFRHPRQEVNPDDHP----VLFHLPSTDANLTENGPSKPI 308
gi 156092664 240 VGAGTDLNAIPVPLDGDRDGLDV-----DDHGAMNILAVSAGRPDELKDSLSESI----ELALPLPTAVTSPNDKPSKPI 310
                        330       340       350       360       370       380       390
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 156092998 314 YYAGLSALGVFFTSMVLykytplgsfirslvsKKEKLRQTTNKHLAQQWLQRTSEYMDPNSENAHYNFPYHNIQN 388
gi 156093017 334 YYAGLSVSGVFFTSMVF---------------KKKKLRQTTNKHLAEQWLQRTSEYMDLNSESAHYNFPYHNIRK 393
gi 156093008 288 YYAGLSLSGVFFTSMVLykytalgplirslvsKKEKLRQTTNKHLAQQWLERTSEYMDSNSENSHYNFPYQSMQN 362
gi 156092882 309 YYAGLSVSGVFFTSMVLykytalgplirslvsKKEKLRQTTNKHLAEQWLQRTSEYMDSNSENSHYNFPYHSMQN 383
gi 156092664 311 YYAGLSTLGVVFTSTVLykyttlgpfirslvsKKENLRQTTNKHLAEQWLQKTSEYMDSNSENSHYNFPYHSMQN 385
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap