Conserved Protein Domain Family
PTZ00238

?
PTZ00238: PTZ00238 
expression site-associated gene (ESAG); Provisional
Statistics
?
PSSM-Id: 140265
View PSSM: PTZ00238
Aligned: 13 rows
Threshold Bit Score: 587.08
Threshold Setting Gi: 72387487
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72387692    1 MKVKIIEWLVFLSFVIYTEGAEDEGRCRLVDDHSF-KNLHESVCYLSCLSDALNKLYTNGERKLLVNEEVYANASRILDD 79
gi 72386453    1 MKVVAVELIILYFFVICIGGEEEGGKCRLVADVGGfAHINVSLCYLHCLSNALNKLYTDGEQRLFVNEEVYANASRILDD 80
gi 71743860    1 MKVIVERCLAFSLFVICIGGAEEEGPCTLVDDYYK-KNLKETLCYLRCLSNALNKLYTDGERKMLVNEEVYANASRILDD 79
gi 71746438    1 MRVVILEWTILILLIVGAYGDND---HALVADYEGdAPLSETVCYLRCLSDALNKLYTDGEKKLLVNEEVYANVSRILDS 77
gi 74026410    7 KKTRIGVWLSLSFLLISFSLARD---CTLVDDYYG-KNVPESVCYLSCLSNALNKLYNDGEEKLFVNEEVYADASRILDD 82
gi 72387487    1 MKVEIVELAILLSFIICVDGENVEHNCKTVDDYYF-RNINESVCYLSCLSNALNKLYSDGEKRLFVNEEAYANASRILDD 79
gi 72386843    1 MKIKIVGLVVFFFVTF---GVAEESYCTSIDDDKG-TNLNQSVCYLKCLSDALNKLYTDGERKLFLNEEVYANASRMLDD 76
gi 72389672    1 MKITIVELVILLFFAVNIDG--EGGACMLLADVENdVSLDESVCYLSCLSSALSKLYTDGERKMFVNEEVYANASRILDD 78
gi 115504819   1 MKVTIAELVVLLFSVICIDGKEENG-CTLITDYHGdAPLSESVCYLSCLSDALNKLYADGENKLFVNEEVYANAFRILDD 79
gi 115504835   1 MKVAVFQWLIWAFLMACACGKDD---YTLVTDHEGdAPLNESVCYLSCLSDALNNLYSDSEKRLFVNEEVYANASRILDD 77
gi 115504843   1 MKVVIVELVISLLLVVYVCGAEEDGTCRLVADSGGhSHLNESVCYLSCLSSALNKLYTDGERKMLVNEEVYANASRILDD 80
gi 115504779   1 MKVTIAELVVLLFSVICIDGKEDNG-CTLITDYHGdAPLSESVCYLSCLSDALNKLYSEGERRLFVNEEVYANAFRILDD 79
gi 115504771   1 MKVTIAELVVLLFSVICIDGKEDNG-CTLITDYHGdAPLSESVCYLSCLSNALNKLYSEGERRLFVNEEVYANAFRILDD 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72387692   80 MEGRAGESVKYLSVISDAMGGKHDKLEKLISYGNTMGDLVAKVGGLFADVNESVRVVRELLPTALMEANRYYTASAEITR 159
gi 72386453   81 MEGKTGESTTYLSVFSSSMGEQNDKLEKLISYGNEMGDLVAKVGGLFAEVNESVREVRNELPNTLIKANKYYTAIAVITK 160
gi 71743860   80 MEGKTGESTKYLSVVSSAMGDQRKKMEKLISYGNEMGDLVAKVGGLFSEVNESVRAVRKYLPDALTTANKYYASIAEITR 159
gi 71746438   78 MEAKTGESVKYLSVISGAMVGESEKLEKLISYGNTMGDLVAKVGGLFAEVNESVRTVRKEIPDALIKANKYYTSIAEIVR 157
gi 74026410   83 MEGETAECVKYLSVISGVMEGKHDKLEKLISYGNEMGDLVAKVGGLFADVNESVRAMREVLPSTLITANKYYTAISEIVR 162
gi 72387487   80 MEGKTGESTKYLSVISSVMEGEHDKLEKLISYGNQMGDLAAKAGGLFVEVNESVRAVRKEIRDALIQANKYYTAVAEIAG 159
gi 72386843   77 MEGKTGESVIYLSVISSVMVEENDKLENLISYGNAMGDLVAKAGGLFAEVNESVRAVRNAIPGALITSNKYYTAIAEIAR 156
gi 72389672   79 MEWKSGESATYLSVISGVMEGKHDKLEKLISYGSAMGDLVAKVGGLFVGVNESVRAVRNAVPDALITANKYYTAAAEVER 158
gi 115504819  80 MEGRTGESVRYLSIISGVMEGKHDKLKKLISYGNAMGDLVAKAGGLFAEVNESVRAVRKEIPGALIKVNKYYTAIAVITR 159
gi 115504835  78 MEGKSGESTKYLSVISSVISKQNDKLEKLISYGNEMGDLVANVGGLFSEVNESVRAVREVLPSALIRANKYYTAIAEIVR 157
gi 115504843  81 MEGKTGESTEYLSVISGVMESEHDKLEKLITYGNEMGDFVAKAGGLFAEVNESVREVRKVLPSALMEANKYYAAIAEITR 160
gi 115504779  80 MEGRAGESVRYLSIISVAMVEENNRLEKLISHGNAMGDLVAKAGGLFAEVNESVRAVRKEIPGALIKVNKYYTAIAEITR 159
gi 115504771  80 MEGRAGESVRYLSIISVAMVKENNRLEKLISHGNAMGDLVAKAGGLFAEVNESVRAVRKEIPGALIKVNKYYTAIAEITR 159
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72387692  160 TVW--DDVKAVEGSDeeAAKCKGENI-GVTEFPTTCGNHTCPLRDNVSDDTLQKYKDGCLEINVLktPGYVSECLNRPRN 236
gi 72386453  161 TVW--NDVKAVGLDSd-MAKCSRQEFsAVENFEASCGDQTCPLENSVTESSLQKYKDGCLTITIL--NGSVSECLNRLRD 235
gi 71743860  160 TAW--DDVKAVEAGG--TAKCEERTFqRVKGLLTPCADQTCPLAKTVNESTLKTYKDGCLAVTVQ--NGSVRECFNLPRD 233
gi 71746438  158 TVW--DDLKAIPTSI--DPKCENGEFdGVKEFEVKCGDSSCPLRNGVSEDALKHYKRGRIEVNVL--NGSVSRCLNLQRK 231
gi 74026410  163 TVW--DDVKAVKSDDeeVLQCRNGKIiSTGEFSVKCSAHTCPLGVNVTESTLKKYKDGCLEINVMteSGQVSKCFNLPRN 240
gi 72387487  160 TVWafDGQKVVEGDH----KCDLEASkKTVEFQSKCSAHTCPLRNGVNKSTLQQYKNGCLEISVMh-SHIVDFCHQSPRN 234
gi 72386843  157 TVW--DDVKAVSNDE--GPECKKGALkGVRGFPVVCVDQTCPLLTGVNEITLQKYRGGCLQIDVLtgSGSVSKCLNLPRD 232
gi 72389672  159 TVW--DDVKGMEAPRm-SAECSDPVFtNVAGYKVICPDYVCPFNHGVTAAAFRKYKNECLEITVY--YPNKCRAQGLPRG 233
gi 115504819 160 TVW--DDVEALERDS--DPNCHGEKIkNVGEFQVTCGEHFCPLKEGVNESTLQKYKDGCLEINVQdkSGQISECLNLPRN 235
gi 115504835 158 TVW--DDVNRPLKQD--EAKCGNQNFgSVGEPKNECVYRTCPLGDGVSEDTLQHYKKGGIEINVQ--TGSVSECFNRPRD 231
gi 115504843 161 TLW--DDAKAVKSDDeeVLQCRNGKIiSTGEFAVKCSAHTCPLEANVTESNLKMYKDGCLEINVM--GGSVSKCFNLPRN 236
gi 115504779 160 TVW--DDVKAVESGK---HECKDQEFrGVKEFDVTCGDNACLLAHGVSEGALKHYKNGLLEINVM--SGSVSKCLNLPRN 232
gi 115504771 160 TVW--DDVKAVESGK---HECKDQEFrGVKEFDVTCGDNACLLAHGVSEGALKHYKNGLLEINVMtkSGGVSKCLNLPRN 234
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72387692  237 KLYMDGAVNNLSDTIKWRgesRDGAIFFQLTVQVQNVFGPLIGPFSAGQPPPVLLEVMSNITSLHSHFNKVHNNFTSLLF 316
gi 72386453  236 NLYRSGAVQSSRKILEWRgedRHGAFYFQLTLEIQQIFSTLITPFAAGKPPFALLDMMANITSLNSHFNWVHGNFTSLLL 315
gi 71743860  234 NLYRSGAVKNSNDALEWKe-vRDRGASFQLKVKVQEIFGPLITPFAAGQPPSMLLGMVSNITSLHSQFNKVHNNFTSLLF 312
gi 71746438  232 NLYKNGAEKHSSEVLKWP---QDDATFFQLKLEVQSMFGPLIVSFAAGRTTSALLEMVENITSLRSRFKEIHSDFTSLLL 308
gi 74026410  241 NLYISGARINSSGVLEWS---QNDSAFFRLIVKVQDIFAPLIAPFSAGKPPSVLLTKMTNITSLYSHFNKVHNNFTSLLR 317
gi 72387487  235 VLYVSGAVKDSGNALKWK-----PGHAFFLTIEVKGIFSSLIASFTAGHPPPVLLAMVSNMTLLYSLFSETYSNFTSLLL 309
gi 72386843  233 NLYKGGAVKNSTGLINWR---ENGPAFFQLQIYVEEIFDPLIEPFTSGKAPPELLDMMANITLLQSYFNDIHRNFTSLQF 309
gi 72389672  234 KLYGNGIVKNLTTLLEWR----DDHSYFQLTLKIRQMLDPLIVPFASGFPPSVLVGTLSNITSLYSHFNEVYSNFTSLLL 309
gi 115504819 236 SLYKNGAVKYSSDGTNWY---GNGNTYFQLKLHVHSMLSPLTIPLGAGQPPSAPLDMMASITSLYSRFNEIHKNFTSLLL 312
gi 115504835 232 NLYRNGAEKHSSDVLKWL---EGETTRLQLTVEVQKIFGPLIVPFAAGQSPSALRAMMSNITFLYSHFKEVHSNFTLMLH 308
gi 115504843 237 NLYISGARINSSGVLEWF---ENGASFFRLIVKVQDIFAPLIAPFAAGKPPSVLLTKMTNITSLYSQFNKVHNNFTSLLL 313
gi 115504779 233 NLYLNGAINSSHGLLKWR---QHSAEMFQLELRVKNIFNPLVASFAAGQSSSVLAEMMANITSLYSRFNEVHRSFTSLLV 309
gi 115504771 235 NLYKSGAVNNSNKVLDWRd-dADTVTHFLLKLKIRDIFSTLIAPFAAGQPPSALLDMMANITSLYSRFNEVHRSFTSLLF 313
                        330
                 ....*....|....*..
gi 72387692  317 DIDVAGNVT--TANSSI 331
gi 72386453  316 DIGVAGNVS--NTNSTI 330
gi 71743860  313 DIDVAGNVT--TANSSI 327
gi 71746438  309 NPNSTDNVN--STDSTI 323
gi 74026410  318 DTNITVNADntNTNSTI 334
gi 72387487  310 GTSITDNLN--STDSTT 324
gi 72386843  310 STNNIDNMK--STNFTI 324
gi 72389672  310 GTNTPENVN--RTNFPI 324
gi 115504819 313 NTNFTGIVN--SSNSDF 327
gi 115504835 309 DTNITDNLN--STHSTI 323
gi 115504843 314 ENNITGNVN--KTRSSF 328
gi 115504779 310 NPNLTDTGD--GIDSIF 324
gi 115504771 314 DTNSIDNVK--STNSTI 328
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap