Conserved Protein Domain Family
PTZ00240

?
PTZ00240: PTZ00240 
60S ribosomal protein P0; Provisional
Statistics
?
PSSM-Id: 140267
View PSSM: PTZ00240
Aligned: 10 rows
Threshold Bit Score: 587.314
Threshold Setting Gi: 71668474
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71754749    1 MPSVSQEKRDYEDRLNGCLTKYSRVLFCLMDNVRSQQVHGVRRDLRGKGELVMGKKTLQKKIVEKRAEGNKATDADKLFH 80
gi 71668472    1 MPSVSEAKREYEERFNGCLTKYGRVLFCLMDNVRSQQVHDVRRDLRGLGELVMGKKTLQKKIVERRAEDKKASAYDKLLY 80
gi 71668474    1 MPSVSKAKREYEERFNGCLTKYGRVLFCLMDNVRSQQVHDVRRDLRGLGELVMGKKTLQKKIVERRAEDKKASAYDKLLY 80
gi 71754751    1 MPSVSQEKRDYEDRLNGCLTKYSRVLFCLMDNVRSQQVHGVRRDLRGKGELVMGKKTLQKKIVEKRAEGNKATDADKLFH 80
gi 73544403    1 MPSITTAKREYEERLVDCLTKYSCVLFVGMDNVRSQQVHDVRRALRGKAEFMMGKKTLQAKIVEKRAQAKDASAEAKHFN 80
gi 73544405    1 MPSITTAKREYEERLVDCLTKYSCVLFVGMDNVRSQQVHDVRRALRGKAEFMMGKKTLQAKIVEKRAQAKDASAEAKHFN 80
gi 146090844   1 MPSITTAKREYEERLVDCLTKYSCVLFVGMDNVRSQQVHDVRRALRGKAEFIMGKKTLQAKIVEKRAQAKDASPEAKRFN 80
gi 146091271   1 MPSITTAKREYEERLVDCLTKYSCVLFVGMDNVRSQQVHDVRRALRGKAEFIMGKKTLQAKIVEKRAQAKDASPEAKRFN 80
gi 154339904   1 MPSITIAKREYEEHLVDCLTKYSCVLFVGMDNVRSQQVHDVRRALRGKAEFVMGKKTLQAKIVEKHAQAKNASPGAKHFS 80
gi 154339906   1 MPSITIAKREYEEHLVDCLTKYSCVLFVGMDNVRSQQVHDVRRALRGKAEFVMGKKTLQAKIVEKYAQAKNASPGAKHFS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71754749   81 QVCTDKQLLCGNTSMIFTNSEVSDITSVLDSHRVQAPARVGAIAPCDVIVPAGNTGMEPKATAFFQALNIATKISKGTVE 160
gi 71668472   81 NTCIEKKLLCGNTALIFTNEEIPVITAVLDKHRVQAPARVGAIAPCDVIVPAGNTGMEPKATSFFQALNIATKIAKGTVE 160
gi 71668474   81 NTCIEKKLLCGNTALIFTNEEIPVITAVLDKHRVQAPARVGAIAPCDVIVPAGNTGMEPKATSFFQALNIATKIAKGTVE 160
gi 71754751   81 QVCTDKQLLCGNTSMIFTNSEVSDITSVLDSHRVQAPARVGAIAPCDVIVPAGNTGMEPKATAFFQALNIATKISKGTVE 160
gi 73544403   81 DQCEEYNLLSGNTGLIFTNNAVQEITSVLDAHRVKAPARVGAISPCDVIVPAGSTGMEPTQTSFFQALNIATKIAKGMVE 160
gi 73544405   81 DQCEEYNLLSGNTGLIFTNNAVQEITSVLDAHRVKAPARVGAISPCDVIVPAGSTGMEPTQTSFFQALNIATKIAKGMVE 160
gi 146090844  81 DQCEEYNLLSGNTGLIFTNNAVQEITSVLDAHRVKAPARVGAISPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVE 160
gi 146091271  81 DQCEEYNLLSGNTGLIFTNNAVQEITSVLDAHRVKAPARVGAISPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVE 160
gi 154339904  81 EQCEEHNLLSGNTGLIFTNDNVQEIKAVLDSHRVKAPARVGAIAPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVE 160
gi 154339906  81 EQCEEHNLLSGNTGLIFTNDNVQEIKAVLDSHRVKAPARVGAIAPCDVVVPAGSTGMEPTQTSFFQALNIATKIAKGMVE 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71754749  161 IVSDKKVLSTGDKVDNSTATLLQKLDISPFYYQVEVQSVWDRGVLFTREDLSVTDAVVEKYLLEGISNISAMSLGAGIPT 240
gi 71668472  161 IVSDKKVLSVGDRVDNSTATLLQKLDISPFYYQVEVQSVWDRGMLFLREDLSITDDVVEKYLLEGISNVAALSLGAGIPT 240
gi 71668474  161 IVSDKKVLSAGDRVDNSTATLLQKLDISPFYYQVEVQSVWDRGMLFLREDLSITDDVVEKYLLEGISNVAALSLGAGIPT 240
gi 71754751  161 IVSDKKVLSTGDKVDNSTATLLQKLDISPFYYQVEVQSVWDRGVLFTREDLSVTDAVVEKYLLEGISNISAMSLGAGIPT 240
gi 73544403  161 IVTEKKVLSVGDKVDNSTATLLQKLNISPFYYQVNVLSVWDRGVLFTREDLMMTEDMVEKMLMDGLSNVAAMALGAGIPT 240
gi 73544405  161 IVTEKKVLSVGDKVDNSTATLLQKLNISPFYYQVNVLSVWDRGVLFTREDLMMTEDMVEKMLMDGLSNVAAMALGAGIPT 240
gi 146090844 161 IVTEKKVLSVGDKVDNSTATLLQKLNISPFYYQVNVLSVWDRGVLFTREDLMMTEDMVEKMLMEGLSNVAAMALGAGIPT 240
gi 146091271 161 IVTEKKVLSVGDKVDNSTATLLQKLNISPFYYQVNVLSVWDRGVLFTREDLMMTEDMVEKMLMEGLSNVAAMALGAGIPT 240
gi 154339904 161 IVTEKKVLSTGDKVDNSTATLLQKLNISPFYYQVDVLSVWDRGVLFTREDLGMTEDIVEKMLMEGLSNVAAISLGAGIPT 240
gi 154339906 161 IVTEKKVLSTGDKVDNSTATLLQKLNISPFYYQVDVLSVWDRGVLFTREDLGMTEDIVEKMLMEGLSNVAAISLGAGIPT 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71754749  241 AATLPHMIVDAFKTLLGASVATNYEFEEYDGKNLRTAALEGKLGGGEAAAPAAAAAAAApAAAPAAAAAEEEEDDDDFGM 320
gi 71668472  241 AATLPHMIMDAFKTLLGASVATEYEFDEFDGKNLRKAALEGNLGGGVADAAAAADTGAA-AAPAAAAEPEEEDDDDDFGM 319
gi 71668474  241 AATLPHMIMDAFKTLLGASVATEYEFDEFDGKNLRKAALEGNLGGGAADAAAATDTGAA-AAPAAAAEPEEEDDDDDFGM 319
gi 71754751  241 AATLPHMIVDAFKTLLGASVATNYEFEEYDGKNLRTAALEGKLGGGEAAAPAAAAAAAApAAAPAAAAAEEEEDDDDFGM 320
gi 73544403  241 PSTIGPMLVDAFKNLLAVSVATSYEFEEHNGKELREAAINGLLAGSCSAAAEPAAAAPA-APSAAAKEEPEESDEDDFGM 319
gi 73544405  241 PSTIGPMLVDAFKNLLAVSVATSYEFEEHNGKELREAAINGLLAGSCSAAAEPAAAAPA-APSAAAKEEPEESDEDDFGM 319
gi 146090844 241 SSTIGPMLVDAFKNLLAVSVATSYEFEEHNGKELREAAINGLLAGSGSAAAEPAAAAPA-APSAAAKEEPEESDEDDFGM 319
gi 146091271 241 SSTIGPMLVDAFKNLLAVSVATSYEFEEHNGKELREAAINGLLAGSGSAAAEPAAAAPA-APSAAAKEEPEESDEDDFGM 319
gi 154339904 241 SATIGPMLVDAFKNLLAVSVATSYVFEEHNGKELREAALSGSLVGAGSAAVESAAAAPA-ASSAAAKVESEESEEDDFGM 319
gi 154339906 241 SATIGPMLVDAFKNLLAVSVATSYVFEEHNGKELREAALSGSLVGAGSAAVESAAAAPA-ASSAAAKVESEESEEDDFGM 319

                 ....
gi 71754749  321 GALF 324
gi 71668472  320 GALF 323
gi 71668474  320 GALF 323
gi 71754751  321 GALF 324
gi 73544403  320 GGLF 323
gi 73544405  320 GGLF 323
gi 146090844 320 GGLF 323
gi 146091271 320 GGLF 323
gi 154339904 320 GALF 323
gi 154339906 320 GALF 323
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap