Conserved Protein Domain Family
PTZ00245

?
PTZ00245: PTZ00245 
ubiquitin activating enzyme; Provisional
Statistics
?
PSSM-Id: 140272
View PSSM: PTZ00245
Aligned: 4 rows
Threshold Bit Score: 446.427
Threshold Setting Gi: 157871530
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154340229   1 MIDAEAVRYDRQIRLWGKATQQQIMHTSVALHGIAGAAAEVTKNLVLAGVRAVAVADEGHVTDVDVCTNYLMQGEGGGTR 80
gi 146091599   1 MREAEAVRYDRQIRLWGKSTQQQLMHTSVALHGVAGAAAEAAKNLVLAGVRAVAVADEGLVTDADVCTNYLMQGEAGGTR 80
gi 146096029   1 MREAEAVRYDRQIRLWGKSTQQQLMHTSVALHGVAGAAAEAAKNLVLAGVRAVAVADEGLVTDADVCTNYLMQGEAGGTR 80
gi 157871530   1 MRDAEAVRYDRQIRLWGKSAQQQLMHTSVALHGVAGAAAEAAKNLVLAGVRAVAVADDGLVTDADACTNYLMQGEAGGTR 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154340229  81 GARALSALQRLNPYVTVYDAVTKLDGSSGPRVTMATVASVEDAVPHAHAAVPGADIVALHVTCGPTVLALFLYRRLPARS 160
gi 146091599  81 GARALGALQRLNPHVSVYDAVTKLDDSSGTRVTMAAVITEEDAVPHVQAALPCADIVALHATCGPTVLALFLYRRLPAHS 160
gi 146096029  81 GARALGALQRLNPHVSVYDAVTKLDDSSGTRVTMAAVITEEDAVPHVQAALPCADIVALHATCGPTVLALFLYRRLPAHS 160
gi 157871530  81 GARALGALQRLNPHVSVYDAVTKLDGSSGTRVTMAAVSTEEDAVPHVQAALPCADIVALHVTCGPTVLALFLYRRLPVHS 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154340229 161 LAEQWRCLVAEPSLLAEKPRGYQRVVLALHVRTDAVSLGFAAAAAKAYEVVERLHLQQLTAADVQEVLQSCAHDAGSGDC 240
gi 146091599 161 LAEQWRCLVAEPSLLAEKPRGYQRAVLALHVRTEAVSLGFAAAAAKAYEVVSRLQLQQLTAADVQEVLQTCAHGAGSADC 240
gi 146096029 161 LAEQWRCLVAEPSLLAEKPRGYQRAVLALHVRTEAVSLGFAAAAAKAYEVVSRLQLQQLTAADVQEVLQTCAHGAGSADC 240
gi 157871530 161 LAEQWRCLVAEPSLLAEKPRGYQRAVLALHVRSKAVSLGFAAAAAKAYEVVSWLQLQQLTAADVQEVLQTYAHGAGSADC 240
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*..
gi 154340229 241 VSDTIAGACIAQHLIRQISALDQPPDAQSYHWMLCECGAEVECLVGL 287
gi 146091599 241 VSDTIAGACIAQHLIRQIGALNQPPDAQSYHWMLCECGAEVECLVGL 287
gi 146096029 241 VSDTIAGACIAQHLIRQIGALNQPPDAQSYHWMLCECGAEVECLVGL 287
gi 157871530 241 VSDTIAGACIAQHLIRQIGALNQPPGAQSYHWMLCECGAEVECLVGL 287
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap