Conserved Protein Domain Family
PTZ00249

?
PTZ00249: PTZ00249 
variable surface protein Vir28; Provisional
Statistics
?
PSSM-Id: 140276
View PSSM: PTZ00249
Aligned: 3 rows
Threshold Bit Score: 912.492
Threshold Setting Gi: 156092479
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156092982   1 MATNPQ---YIKYQDYYIVKKSFVYTPTDEFNISFVNALIKDIRNTPTKEKLLYKTFYELKKFISRNHSFLEYGKEKCCN 77
gi 156092479   1 MSRNPPtlwYFNYHDYTEIKNIFDYTPSDIYDVIVANDLIKPISNTTPKELELLKTFNDLKKMILRHPCVIRHGQETCCN 80
gi 156092890   1 MATNPQ---YIKYQDYYIVKKSFDYTPTDEFNISFVNALIKDIRNTPTKEKLLYKTFYELKKFVKRHHCFMYYDKENCYK 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156092982  78 YINYWLNKTVRDSEYGVNKEKFKFFDEFMQRDPKASDGPFNCISKLSYMDTDSFQKMKKLYDLYDYFTELKEHEDSSTLC 157
gi 156092479  81 YINYWLNKTVRDSEYNVNKQNFNIFDKFMQDDPKIKEGPTTCKSKLSYMDTDTFKKMEKLYDLYDYFTKLKESKVPTTLC 160
gi 156092890  78 YINYWLNKTIRDSNYNITKENFKVFYDFKNYDPDDNADLFDSISKLRYMDTDSFQKMEKLYGLYDYFTEQKESHDSSSLC 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156092982 158 RSISDLAKKYESMMREY-EKDNKLCNMLTNLRGVIERDKLVAKDICEKNTFDSFILKIDPPREEQKEVTAHAYRGISGEA 236
gi 156092479 161 HNISDLTEKYESVFKECnGKDNNLCDKLTNLKNVIVKDKLVANNICTKEAFDSFILKIDPPREEQKAVTAPAHRRISGEA 240
gi 156092890 158 RNISKIAEKYKSMMQEYkEKDHKLCEVLTNLKDIIESDKLVAKNICTKNTSDLFYLKIDPPREEQKAVSAHAQRRISGEA 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156092982 237 RPPkhssvsspqvhrgisvetrptNPVSASLPQAHGRSPGETHTRPLVTAPSSRVHDRNSVQTPTPTXVSVSLSQAKGLE 316
gi 156092479 241 RPP---------------------NPVSVSSLQVHGRHPGKTHPPKHVSVPSQKAHGRHPGEKPTPPSVSGYSSPAQGLE 299
gi 156092890 238 RPPkhisfssphahgrppvetrppNPVSVSSPQAHGRPPGETHTPPLVTVPSSHAHDRNTVQTSTPTPVSEYSSQAKGLE 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156092982 317 KPAGGESERTLSVPQEQSPRPLPlLLPLPSLEQSDPLESSEADEYGGPKGL-------TETESELRQEPQDEERYQLERD 389
gi 156092479 300 TQARVESERTSSVPSEQFPLPLP-LLPLGQSGPLESSETEETDEYARPKGL-------PEPELPQVELQEEDQVHGLKHD 371
gi 156092890 318 KQAGGESERTSSVLPKRFPLPVPvVLS----------ESTETEEETGPMGPyrisgqePEPEPELELPQEQGRRIDTLTD 387
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156092982 390 VDPFNEDEEYTSLQEVDPPAGSMQSTFDTGTIMGTIKGAVSNVLGAVEPVPVLGVSGGMGALYLLLKYTPVGSLFGRNRR 469
gi 156092479 372 VDTFREVEEDTFLQEGDQPAGSTMPTYDTGTIMGTIKGAVYNVLEAVEPVPVLGVSGGMGALYLLLKCTPIGSLFRRNRR 451
gi 156092890 388 SYYFRED-------EGDLRAGSMQSTFDTGTIMGTIKDAVSNVLEAVEPVPVLGVSGAIGALYLLFKYTPIGSLFRRNRR 460
                        490       500       510       520
                 ....*....|....*....|....*....|....*....|....*.
gi 156092982 470 NNQYIPNFYDPGYREQYSDYYPEYYNEDFPNNRMNIAYHPSSYELD 515
gi 156092479 452 NNQNIPNFFDPRYGEQFSGYYPQYYNEGFSNYRMNIAYYPSSEELD 497
gi 156092890 461 NNQNIPNFFDPEYGEQFSGYYPQYYNEGFPNYRMNIAYHPSSEELD 506
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap