Conserved Protein Domain Family
PTZ00250

?
PTZ00250: PTZ00250 
variable surface protein Vir23; Provisional
Statistics
?
PSSM-Id: 140277
View PSSM: PTZ00250
Aligned: 2 rows
Threshold Bit Score: 567.295
Threshold Setting Gi: 156093010
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156093010   6 IHYPXIERTGDkepaSSEVYTLIKNLTLYEFYELLDNELVKNYEP----DDRCNHCKNQIASDQTNGAELIDLCKKCCNI 81
gi 156092257   1 MSYLSLLYSGE----NKETYSILKNLNLYDFYEKLDNELDKKIEEtpeiKQKCDYCQGHIASQAENGEKLIELCKKICNI 76
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156093010  82 ILNVNNILDKYKSSDDKKKCQYMSHWLYDKVVSITQGTNLFINFYAVLSMYSSSNKDNFKNCTLKNFKVDKEAFNKKHIL 161
gi 156092257  77 ILNVHGILNKCNDRTDNKACSYMEYWLYYNVTRYTEEQNIVSKFYALVSMYTTFKSSNFNNCSLTNFAIDKNIFDIKRTL 156
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156093010 162 YEFIESYDDMKNKIDNKSKLYTPLYCKHIKENFLFYNVVKNECTSNESCGYFNELNEFKEKFRQQDVLSFIYEKCEYTKT 241
gi 156092257 157 YEFIEIYEGIKNEILQENNVNVKTYCKHIKENFRYYNIIKESCKSKDTCDYYDEYIQFKNKFKEPSVINLICEKCDYIKT 236
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 156093010 242 SCKHGSNSEDDVPCLQAKGIPFILPILGNDPDDIINILLNVAIISVPFLAIFLILFKFTPFGRKLNRINAKGRKSGSKKK 321
gi 156092257 237 SCQKGSNGEDDVPCLREKGXSFLYXJFGNDADNIINILLKVTTISAPILALFVILFKFTPFGKNLNKLKQERKKSGHKKK 316
                        330       340       350
                 ....*....|....*....|....*....|
gi 156093010 322 EENIEDYMNNYAAYVDNVMKNRVNLTYHAS 351
gi 156092257 317 EVNIQDYMKNYAAHLDSEMKNRVHLGYHAT 346
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap