Conserved Protein Domain Family
PTZ00251

?
PTZ00251: PTZ00251 
fatty acid elongase; Provisional
Statistics
?
PSSM-Id: 140278
View PSSM: PTZ00251
Aligned: 9 rows
Threshold Bit Score: 420.027
Threshold Setting Gi: 157866547
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154334209   1 MQWVDNWGANHYDGYAFKQWLLDNHDIAIYVAVGYITFVFQAPKLVSKYLnlpanaKTSPLVPVINKTWAVWNILLSAFA 80
gi 154334207   1 MQWLDNYGDQRYDGHAVQKWLASNVDVCVYIAGAYLAFVFTGPRVMEALF------HGKPSVAIIKKAWALWNLALSAFS 74
gi 154334211   1 MEALDNYLITHFDGHAVQTWLANNVDIGVYIAAAYLTFVFKGPQLVDFIF------SGNPPSKLIKMCWSLWNVGLAVFS 74
gi 146081423   1 MQWLDNYGDHHYDGHAVQMWLASNVDVCAYIAGAYLAFVFTGPRIMEALF------HGKPPMG-IKKAWALWNLGLSVFS 73
gi 146081427   1 MQWIDSWGANHYDGYAFKQWLLDNHDIAIYVAVGYITFVFQAPKLVSKYLnlpanaKSSPLVPVINKTWAVWNILLSAFA 80
gi 146081431   1 MEALDNYLIAHYDGHAVQKWLASNVDISVYIAAAYLTFVFKGPQLVDLIF------RGNPPTRLIKMCWTLWNIGLAVFS 74
gi 157866545   1 MQWLDNYGDHHYDGHAVQMWLASNVDVCAYIAGAYLAFVFTGPRLMEALF------HGKPPTG-IKKAWALWNLGLSVFS 73
gi 157866547   1 MQWIDSWGANHYDGYAFKQWLLDNHDIAIYVAVGYITFVFQAPKLVSKYLnlpanaKSSALVPVINKTWAVWNILLSAFA 80
gi 157866549   1 MEALDNYLIDHYDGHAVQKWLVNNVDIGVYIAAAYLTFVFKGPQLVDFIF------RGNPPTRLIKMCWTLWNIGLALFS 74
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154334209  81 FYGTTRVVPPLLYNLKTYGLHDTLCTFRPDEFYTSDVGVALGLFTISKVPEFGDTFFLVLKGT-KLRFLSWFHHTAMFLY 159
gi 154334207  75 LYGWLRVAPPLLRHLMKDGMHDTLCTFHEDEFYTTKVGFAMGMFAISKVPEFIDTVFLLMRGV-NLSFLSWFHHVTTYLF 153
gi 154334211  75 MYGVYHTIPLFINNLRRYGQKDTLCRFREDEFFTGKHGVAMGLFSLSKLPEFGDTFFLIMGGKrKLPFLSWFHHVTIFLY 154
gi 146081423  74 LYGWLRVGPPLLRHLMNDGLHNTLCTFHEDEFYTTKVGFAIGMFAISKVPEFIDTVFLLMSGV-KLGFLSWFHHVTTYLF 152
gi 146081427  81 FYGTTRVVPPLLYNLKTYGLHDTLCTFRPDEFYTSDVGVALGLFTISKVPEFGDTFFLVLKGT-KLRFLSWFHHTAMFLY 159
gi 146081431  75 MYGVYHIVPLFINNLRKYGQKDALCRFREDEFYTGKNGVAMGLFSLSKLPEFGDTFFLIMGGKrKLPFLSWFHHVTIFLY 154
gi 157866545  74 LYGWLRVGPPLLRRLMHDGLHNTLCTFHEDEFYTTKVGFAIGMFAISKVPEFIDTVFLLMSGV-KLAFLSWFHHVTTYLF 152
gi 157866547  81 FYGTTRVVPPLLYNLKTYGLHDTLCTFRPDEFYTSDVGVALGLFTISKVPEFGDTFFLVLKGT-KLRFLSWFHHTAMFLY 159
gi 157866549  75 MYGVYHTVPLFINNLRKYGQKDTLCRFRDDEFYTGKNGVAMGLFSLSKLPEFGDTFFLIMGGKrKLPFLSWFHHVTIFLY 154
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154334209 160 VWLSYETGSSTLICAAAMNYFVHTIMYFYFFLSEAGFKSLARPFAMYITLLQLAQMVGVMFVSGYVIVQKYIladqgitD 239
gi 154334207 154 VWYSYQQGTSIFICAAAMNYFVHSIMYFYFFLSEAGFKSLVKPFAMYITLLQITQMVGGLFVSGYVLLQKLTe-----gT 228
gi 154334211 155 AWMAYQQASSIWIVLASINYFVHSIMYTYFALAEAGFKSLVKPFAMYITLLQITQMVVGLYFTVSFIVHH---------K 225
gi 146081423 153 AWYSYQQGTSIFICAAAMNYFVHSIMYMYFALSEAGYKKLVKPFAMYITLLQIAQMVGGLFVSGYVLAQKLT-------E 225
gi 146081427 160 VWLSYETGSSTLICAASMNYFVHTIMYFYFFLSEAGFKNLARPFAMYITMLQLVQMVGVMFVSGYVIAQKYIlagqgimD 239
gi 146081431 155 AWMAYQQASSIWIVLASINYFVHSIMYTYFALAEAGFKKLVKPFAMYITLLQIAQMVVGLYFTFSFISYH---------K 225
gi 157866545 153 AWYSYQQGTSIFICAAAMNYFVHSIMYMYFALSEAGFKKLVKPFAMYITLLQITQMVGGLFVSGYVLVQKLT-------E 225
gi 157866547 160 VWLSYETGSSTLICAAAMNYFVHTIMYFYFFLSEAGFKNLARPFAMYITMLQLVQMVGVMFVSGYVIAQKYIlagqgimD 239
gi 157866549 155 AWMAYQQASSIWIVLASINYFVHSIMYTYFALAEAGFKKLVKPFAMYITLLQITQMVVGLYFTFSFISYH---------K 225
                        250       260       270       280
                 ....*....|....*....|....*....|....*....|....*.
gi 154334209 240 GMTGSCSGTTMATARLQLGIYTAFLYLFGEMFMNNHVRPRAAKKAD 285
gi 154334207 229 SKPKTCSGTSISTARTQLVIYIFNFYLFSEMFVKGYVLPRKAPAGE 274
gi 154334211 226 ADPQGCNGSTMALARGQCMIYIFNFYLFSEMFVKGYVLPRKAPAGE 271
gi 146081423 226 NAANACSGTSMSAARTQLVIYIFNFYLFSEMFIKAYVLPRKASVAP 271
gi 146081427 240 GMEGSCSGTTMATARLQLGIYTAFLYLFGEMFVNNHVRPRAAKKVD 285
gi 146081431 226 ADPKGCNGSTMALARGQCMIYFFNLYLFSEMFIKGYVLPRKAAAGD 271
gi 157866545 226 GAGNPCSGTSMSAARTQLVIYIFNFYLFSEMFIKAYVLPRKAGAAL 271
gi 157866547 240 GMEGSCSGTTMATARLQLGIYTAFLYLFGEMFVNNHVRPRVAKKAD 285
gi 157866549 226 ADPKGCNGSTMALARGQCMIYFFNFYLFSEMFIKGYVLPRKAAAGE 271
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap