Conserved Protein Domain Family
PTZ00253

?
PTZ00253: PTZ00253 
tryparedoxin peroxidase; Provisional
Statistics
?
PSSM-Id: 140280
View PSSM: PTZ00253
Aligned: 20 rows
Threshold Bit Score: 406.598
Threshold Setting Gi: 71413203
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71413203    1 MSCGDAKLNHPAPDFNETALMPNGTFKKVALSSYKGKWLVLFFYPMDFTFVCPTEICQFSDRVKEFSDIGCEVLACSMDS 80
gi 71413207    1 MSCGDAKLNHPAPDFNETALMPNGTFKKVALSSYKGKWLVLFFYPMDFTFVCPTEICQFSDRVKEFSDIGCEVLACSMDS 80
gi 71403567    1 MSCGDAKLNHPAPDFNETALMPNGTFKKVALTSYKGKWLVLFFYPMDFTFVCPTEICQFSDRVKEFSDIGCEVLACSMDS 80
gi 71399514    1 MSCGDAKLNHPAPDFNETALMPNGTFKKVALSSYKGKWLVLFFYPMDFTFVCPTEICQFSDRVKEFSDIGCEVLACSMDS 80
gi 71396508    1 MSCGDAKLNHPAPDFNETALMPNGTFKKVALTSYKGKWLVLFFYPMDFTFVCPTEICQFSDRVKEFSDIGCEVLACSMDS 80
gi 71744678    1 MSCGDAKLNHPAPHFNEVALMPNGTFKKVDLASYRGKWVVLFFYPLDFTFVCPTEICQFSDRVKEFNDVDCEVIACSMDS 80
gi 154334618   1 MSCGDAKMNEPAPPFEEMALMPNGSFKKITLASYKGKWVVLFFYPLDFTFVCPTEIIQFSDSIKRFNELDCEVMSCSVDS 80
gi 154334622   1 MSCGDAKMNEPAPPFEEMALMPNGSFKKINLASYKGKWVVLFFYPLDFTFVCPTEIIQFSDSIKRFNELDCEVMSCSVDS 80
gi 157866934   1 MSCGNAKINSPAPSFEEVALMPNGSFKKISLSSYKGKWVVLFFYPLDFTFVCPTEVIAFSDSVSRFNELNCEVLACSIDS 80
gi 157866942   1 MSCGNAKINSPAPSFEEVALMPNGSFKKISLSSYKGKWVVLFFYPLDFSFVCPTEVIAFSDSVSRFNELNCEVLACSIDS 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71413203   81 EYSHLAWTSIERKRGGLGQMNIPILADKTKCIMKSYGVLKEEDGVAYRGLFIIDPKQNLRQITVNDLPVGRDVDEALRLV 160
gi 71413207   81 EYSHLAWTSIERKRGGLGQMNIPILADKTKCIMKSYGVLKEEDGVAYRGLFIIDPKQNLRQITVNDLPVGRDVDEALRLV 160
gi 71403567   81 EYSHLAWTSIERKRGGLGQMNIPILADKTKCIMKSYGVLKEEDGVAYRGLFIIDPKQNLRQITVNDLPVGRDVDEALRLV 160
gi 71399514   81 EYSHLAWTSIERKRGGLGQMNIPILADKTKCIMKSYGVLKEEDGVAYRGLFIIDPKQNLRQITVNDLPVGRDVDEALRLV 160
gi 71396508   81 EYSHLAWTSIERKRGGLGQMNIPILADKTKCIMKSYGVLKEEDGVAYRGLFIIDPKQNLRQITVNDLPVGRDVDEALRLV 160
gi 71744678   81 EFSHLAWTNVERKKGGLGTMNIPILADKTKSIMKAYGVLKEEDGVAYRGLFIIDPQQNLRQITINDLPVGRNVDETLRLV 160
gi 154334618  81 EYAHLQWTLQERKKGGLGPMEIPMLADKTKCICRAYGVLDEKKGVAYRGLFIIDPKGILRQIIVNDMPVGRNVEEALRLL 160
gi 154334622  81 EYAHLQWTLQERKKGGLGPMEIPMLADKTKCICRAYGVLDEKKGVAYRGLFIIDPKGILRQIIVNDMPVGRNVEEALRLL 160
gi 157866934  81 EYAHLQWTLQDRKKGGLGTMAIPMLADKTKSIARSYGVLEESQGVAYRGLFIIDPHGMLRQITVNDMPVGRSVEEVLRLL 160
gi 157866942  81 EYAHLQWTLQDRKKGGLGTMAIPMLADKTKSIARSYGVLEESQGVAYRGLFIIDPHGMLRQITVNDMPVGRSVEEVLRLL 160
                        170       180       190
                 ....*....|....*....|....*....|....*....
gi 71413203  161 KAFQFVEEHGEVCPANWKPGDKTMKPDPEKSKEFFGAVA 199
gi 71413207  161 KAFQFVEEHGEVCPANWKPGDKTMKPDPEKSKEYFGAVA 199
gi 71403567  161 KAFQFVEKHGEVCPANWKPGDKTMKPDPEKSKEYFGAVA 199
gi 71399514  161 KAFQFVEKHGEVCPANWKPGDKTMKPDPEKSKEYFGAVA 199
gi 71396508  161 KAFQFVEKHGEVCPANWKPGDKTMKPDPEKSKEYFGAVA 199
gi 71744678  161 KAFQFVEKHGEVCPANWKPGSKTMKADPNGSQDYFSSMN 199
gi 154334618 161 EALQFVEKHGEVCPANWKKGDATMKPERQASIEGYFSTV 199
gi 154334622 161 EALQFVEKHGEVCPANWKKGDATMKPERQASIEGYFSKQ 199
gi 157866934 161 EAFQFVEKHGEVCPANWKKGAPTMKPEPNASVEGYFSKQ 199
gi 157866942 161 EAFQFVEKHGEVCPANWKKGAPTMKPEPNASVEGYFSKQ 199
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap