Conserved Protein Domain Family
PTZ00267

?
PTZ00267: PTZ00267 
NIMA-related protein kinase; Provisional
Statistics
?
PSSM-Id: 140293
View PSSM: PTZ00267
Aligned: 5 rows
Threshold Bit Score: 1005.31
Threshold Setting Gi: 71663773
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154345339   1 MTAREgepnSASMELLNQYAKYFPHVLFTSHKAFEKYVASLDPEVYNNCVDLPEGEESLES--RNPQEHMYVLTTLVGRN 78
gi 71663773    1 MPNND----SHDAQLLRHYAQFFPNVLFTSEEEMEKYCQDARPDAVKKVLDLPEGEEVPEDamNDPRAHLYILKHIVGRN 76
gi 71659618    1 MPNND----SHDAQLLRHYAQFFPNVLFTSEEEMEKYCQDARPDAVKKVLDLPEGEEVPEDamNDPRAHLYILKHIVGRN 76
gi 72549995    1 MPAKEvehgSASTELLNQYAKYFPHVLFTSQEAFEKHAATLDPEVYKTCVDLPEGEESPES---NPREHMYVLTTLVGRN 77
gi 146102203   1 MPPKEvehgSASTELLNQYAKYFPHVLFTSDEAFEKHAATLDPEAYKNCVDLPEGEEPPES---NPREHMYVLTTLVGRN 77
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154345339  79 PTTAAFVATRCSVpAEKVVAKFVMLSDERQAAYARSELHCLAACTHFGIVKHFDDFKSDDKLLLIMEYGSGGDLNKQIKQ 158
gi 71663773   77 ATTAAFVALRGSD-KQKVVAKFIMLNDEKQAAYARSEVHCLAACDHFGIVKHYDDLKSEDKLLLIMEYGSGGDLNKQIKQ 155
gi 71659618   77 ATTAAFVALRGSD-KQKVVAKFIMLNDEKQAAYARSEVHCLAACDHFGIVKHYDDLKSEDKLLLIMEYGSGGDLNKQIKQ 155
gi 72549995   78 PTTAAFVATRGSDpSEKVVAKFVMLNDDRQATYARSELHCLAACKHFGIVKHFDDFKSDDKLLLIMEYGSGGDLNKQIKQ 157
gi 146102203  78 PTTAAFVATRGSDpSEKVVAKFVMLNDDRQATYARSELHCLAACKHFGIVKHFDDFKSDDKLLLIMEYGSGGDLNKQIKQ 157
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154345339 159 RLKEHLPFQEYEVGLLFYQIVLALDEVHSRCMMHRDLKSANIFLMPTGIIKLGDFGFSKQYSDSVSLDVASSFCGTPYYL 238
gi 71663773  156 RLKERLPFKEHEAGLLFYQIVLALDEVHSRKMMHRDLKSANIFLMPTGIIKLGDFGFSKQYTDSVSLDVGSSFCGTPYYL 235
gi 71659618  156 RLKERLPFKEHEAGLLFYQIVLALDEVHSRKMMHRDLKSANIFLMPTGIIKLGDFGFSKQYTDSVSLDVGSSFCGTPYYL 235
gi 72549995  158 RLKEHLPFQEYEVGLLFYQIVLALDEVHSRRMMHRDLKSANIFLMPTGIIKLGDFGFSKQYSDSVSLDVASSFCGTPYYL 237
gi 146102203 158 RLKEHLPFQEYEVGLLFYQIVLALDEVHSRRMMHRDLKSANIFLMPTGIIKLGDFGFSKQYSDSVSLDVASSFCGTPYYL 237
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154345339 239 APEVWERKRYSKKADMWSLGVILYELLTLHRPFKGPSQREILQQVLYGKYDPFPCPVSSTMKALLDPLLSKNPADRPTTQ 318
gi 71663773  236 APELWERKRYSKKADMWSLGVILYELLTLHRPFKGPSQREIMQQVLYGNYDPFPCGVSDGMKAVMEPLLSKDPALRPTTT 315
gi 71659618  236 APELWERKRYSKKADMWSLGVILYELLTLHRPFKGPSQREIMQQVLYGNYDPFPCGVSDGMKAVMEPLLSKDPALRPTTT 315
gi 72549995  238 APELWERKRYSKKADMWSLGVILYELLTLHRPFKGPSQREIMQQVLYGKYDPCPCPVSSSMQALLDPLLSKNPTERPTTQ 317
gi 146102203 238 APELWERKRYSKKADMWSLGVILYELLTLHRPFKGPSQREIMQQVLYGKYDPFPCPVSSSMQALLDPLLSKNPNERPTTQ 317
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154345339 319 QLLHTEFLKYVANLFQDIVRHSETISPNDRTEILKQLQGSGERAPSPSSIRYDVLTSEVTHGGYLYKYSSDMRWKKRYFY 398
gi 71663773  316 QLLHTELMKYVANIFEEIVRNSEVIEKHDKERILRQLAESRAKAPPPNSIQAGAVSNDVVREGYLLKYSSDMKWKKRYFS 395
gi 71659618  316 QLLHTELMKYVANIFEEIVRNSEVIEKHDKERILRQLAESRAKAPPPNSIQAGAVSNDVVREGYLLKYSSDMKWKKRYFS 395
gi 72549995  318 QLLQTEFLKYVANLFQDIVRHSETISPNDRAEILKQLQESGERAPLPSSIRYGVMTSQVTHGGYLYKYGSDCRWKKRYFY 397
gi 146102203 318 QLLHTEFLKYVANLFQDIVRHSETISPSDRTEILRQLQESGERAPLPSSIRYGVMTSQVTHGGYLYKYGSDYRWKKRYFY 397
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154345339 399 IGNGQLRISLSENPENDGVAPKSVNLETVSDAFPVPEVYSQKHPNQLVLWFNNGQKIIAYATTKEDRDVWISKFQRACGM 478
gi 71663773  396 IKNGQLRISLTDNPEKDGVSPKSASLETVNDVFPVPEAYCRSNPHQLVIWFTNGQKIIAMAKSAEERDQWISDFQRACGM 475
gi 71659618  396 IKNGQLRISLTDNPEKDGVSPKSASLETVNDVFPVPEAYCRSNPHQLVIWFTNGQKIIAMAKSAEERDQWISDFQRACGM 475
gi 72549995  398 IGDGQLRISLSENPENDGVAPKSVNLETVGDVFPVPEVYSQKHPNQLVLWFNNGQKIIAYANTMEDRDMWISKFHRACGM 477
gi 146102203 398 IGDGQLRISLSENPENDGVAPKSVNLETVGDVFPVPEVYSQKHPNQLVLWFNNGQKIIAYANTMEDRDMWISKFHRACGM 477
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap