Conserved Protein Domain Family
PTZ00269

?
PTZ00269: PTZ00269 
variant surface glycoprotein; Provisional
Statistics
?
PSSM-Id: 140295
View PSSM: PTZ00269
Aligned: 5 rows
Threshold Bit Score: 879.241
Threshold Setting Gi: 71746298
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                        10        20        30        40        50        60        70        80
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71746310   1 MYWVVVLLTVLHSCHRALGKeDIVNQKEFEALCRMINWAEERLEHIKVTKRVTQEALKIGVRYLEVAGEEECRHIAKAQE 80
gi 71746304   5 MYWVVFLVAVLQGIHLVSGQ-DIVNQQEFEALCRMINWAERGLKHIKLAKQVTEEALSIGIRYLEVADADSAAQLGAAEH 83
gi 71746316   5 MYWVVFLVAALQGIHLVSGQ-DIVNQKEFEALCRIVNWAEKGLKQITLARQVTQEAQKIGVRYLEVVGEENAAELAKTQE 83
gi 71746298   5 MYWVVFLVAVLQGIHLVSGQeEILNEQEFEALCRMINWAERGLKHIKVTKRVTQEALKIGVRYLEVAGEENAAELAEAQD 84
gi 71746300   5 MYWVVFLVAALQGIHLVLGQeEILNEQEFEALCRMINWAERGLKHINLARQVTEEALKIGVRYLEVAGEEEVTELTELQE 84
                        90       100       110       120       130       140       150       160
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71746310  81 DSCT-KKMEDRKRNCGLYKNFWEEAQKAVKERAFSGEKLERKIDALGEHTVDEIKKKGMYGADIYHDVEAKRPSGNMRKM 159
gi 71746304  84 DACM-DKREVREKNCGLYKTFWEESQRLLKEKHERSQAHHRGRNSLQYHTAEEIKSKVMEVADIFHEVKWELLELKVNNM 162
gi 71746316  84 DSCA-YKREVGGRNCVLYKTFWQHAQEALKG-TARSSVHHRAMNTLEYHTIEKIKEKAMHGADIYHDVGAESLSVKVEKI 161
gi 71746298  85 YSCT-KRMEDRKRNCGLYKTFWEEAQRVLNKGVDSGERPERKKNGLREHSAE-IRKKAMEVADIYHEIEAKSPSGQVEKI 162
gi 71746300  85 KACMsNKKTSHEKNCGLYKTFWEESQEALKR-TARSQAPHRGRNSLQYHTAEGIKIKVMEVADTYHEVKKEILKLRTDNM 163
                       170       180       190       200       210       220       230       240
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71746310 160 EEHLIKALYGMEYFSEDIKGGDsDRSRVCGQNLRNNKATGGWSLAVDLLCLCATHNSWKGRKkVCCADCSTGENRDEWNP 239
gi 71746304 163 EEQLNQALYGRTYSAEEIRERE-ERSRVCGQSSRSEMIIGGQSLVMDLLCLCAMHSSWKEMR-VCCADCTTGENGNTWNP 240
gi 71746316 162 ERKINQALYGMEYFTEEIKPGG-DRSRVCGQSSRSEMIIGGNSLAVDFLCLCAMHSSWNGIK-VCCTDCTTGENSNEWDP 239
gi 71746298 163 EEQLNKALYGRTHTAEEIRERE-ERSRVCGKTLPNPPNREDQSLAVDLLCLCAMHGSWNGRE-ICCADCTTGRNSEEWNP 240
gi 71746300 164 EEQLNQALYGVGHFTGEVKGGDsDRSRVCGQNLGNRDATGGWSLAVDLLCLCARHISWSSVKsVCCEECGTGENSNTWNP 243
                       250       260       270       280       290       300       310       320
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71746310 240 ESNEAPRWDFLKQKCAGRHRNRHDMIEKLSEAEENLMKTVTKIGTIPYTHTYVLGTAVNSRIKPCGADINKQQEICVHYG 319
gi 71746304 241 GSNGAPRWKFLKQKCAGATTSYVSVRKTLRGAKQDFMDAVTEISANRRTNLYKLGEKQNKEIKDCGADKNSKEGICVFYR 320
gi 71746316 240 ESNGVQRWKFLKQKCADHNPNYYDTEKRLRNAKQNFMDTVTTIHGRGGRTLYKLGKKQSSEVNNCGAGTGRGQGICVLYK 319
gi 71746298 241 ESNSAHRWEFLKQKCAGVIPSYGSTGERLRDAKQNFMDAVTKITTRRGEQLSKLGEKQNNNVKDCGADTSKSQGICMLYG 320
gi 71746300 244 ALDGALHWEFLKENCPGDNTNHHTEGEQLKSAKKNFMAKVSKIATIPYRTMYKLGDSKNIQTKQCGANIGTGQGICVYYG 323
                       330       340       350       360       370       380       390       400
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71746310 320 SDNGTKLpWLKALQKVEKEMKLTLKDKQDKSAKLKRMEELNQEIESLIRGDTGRGGQRGRQKRSVNPENSVPETPADPSD 399
gi 71746304 321 ERDGVVF-WMKALENVDNKMEVLLQDRTKKTSKLERIKELSQEIESLIKGDTGRGRQQGRQKRSVDTENSVPETPADPSD 399
gi 71746316 320 G-HGEELpWMKALVEVENEMEVLLQDKHNKSAKLERIKELSQEIEKLIKGDPGRGGQRGRQKRSVNPENSVPETPADPSD 398
gi 71746298 321 AVDGVNLpWMKTLESVEDRIGLLMQESQDKTSKLERIKELSQEIESLIKGDTGRGRQQGRQKRSVDTENSVPETPADPSD 400
gi 71746300 324 SDNGANLhWMQALERVENDVEVLLQDSKYKSTKLKRIKELSQEIQNLIEG----GTPRGRQKRSVDTENSVPETPADPSD 399
                       410       420       430       440       450       460       470
                ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*
gi 71746310 400 PTQSVPHTNEKKRSVRKPISTGNGATKSYNSEEDDSYEYECEGENSACSDSPAKPTVKNSKSAINCPLGLILLLV 474
gi 71746304 400 PTQSTTHTNEKKRIVRKPISTGNNASKSYGGDEVDSYDSKCDGENSACSDSPAKPTVKSSKSAINCPLGLILLLV 474
gi 71746316 399 PTQSVPHTNEKKRSVRKPISTGNGATKSYNSEEDDSYEYECEGENSACSDSPAKPTVKNSKSAINCPLGLILLLV 473
gi 71746298 401 PTQSTTDTNRKKQGERKPISTGNGASKSYGGDEVDSYDSKCDGENSACSDSPAKPTVKSSKSAINCPLGLILLLV 475
gi 71746300 400 PTQSTTHTNEKKRIVRKPISTGNNASKSYGGDEVDSYDSKCDGENSACSDSPAKPTVKSSKSAINCPLGLILLLV 474
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap