Conserved Protein Domain Family
PTZ00276

?
PTZ00276: PTZ00276 
biotin/lipoate protein ligase; Provisional
Statistics
?
PSSM-Id: 140302
View PSSM: PTZ00276
Aligned: 6 rows
Threshold Bit Score: 458.176
Threshold Setting Gi: 74025008
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146094843   1 MPAHFPPKIHFLDEVTSTMDVARTMRATA--GGKAFAVVAAEQTAGRGTGGRTWTSPKGNLYMTFGVPQLGQPPclkeEL 78
gi 71402075    1 MPMDVPPNIHHVGEVTSTMDAARQMLTAA--NGVPFAVLAESQVRGRGTGERVWISPKGNMYFTLCIPEKSVTP----EI 74
gi 71664409    1 MPMDVPPNIHHVGEVTSTMDAARQMLTAA--NGAPFAVLAESQVRGRGTGERVWISPKGNMYFTLCIPEKSVTP----EI 74
gi 74025008    1 MSAFLTPKIHLVGDVSSTMDVVREMLAASpsDTEPFAVLAESQSSGRGTTGRQWSSPRGNMYFSLCLPTTLVAA----EF 76
gi 154342354   1 MPANFPPNIQFLEEVGSTMDVARTMKMTA--GGQPFALVAAVQTAGRGTCGRTWTSPKGNLYMTLGIPQQGQPPcfkeEL 78
gi 157873157   1 MPAHCPPNIHFLEEVTSTMDVARTMRATA--GGKAFAVVAAEQTAGRGTGGRTWTSPKGNLYMTVGVPQLGQPPclkeEL 78
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146094843  79 VPVLPLICGLACRLAVLEVLHldrvsakasvaadaAKAVSTKWPNDIIYNHKKIGGTLIENDGDYFIIGIGMNIAVAPQM 158
gi 71402075   75 TPVLPLLTGLVCRAAIMSVIK--------------GAVLHLKWPNDIIYAGKKIGGSLVESEGESLIIGIGMNVELAPPV 140
gi 71664409   75 TPVLPLLTGLVCRAAIMSVIK--------------GADVHVKWPNDIIYAGKKIGGSLVESEGESLIIGIGMNVELAPPV 140
gi 74025008   77 LPVLPLATGLACRAAIMELVE--------------GAVVHVKWPNDIIYDGKKIGGSIAECEGEHLIVGIGINIEVAPPV 142
gi 154342354  79 VHVLPLICGLACRRAVLEVLHldeasakaslaaeaSKAVSTKWPNDIIYKHKKIGGSLIEADGDYFIIGIGVNVAVTPQV 158
gi 157873157  79 VPVLPLICGLACRRAVLEVLHldgalakasvaadaAKAVATKWPNDIIYNHKKIGGTLIESDGDYLIIGIGMNIAVAPQM 158
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146094843 159 TDAGREATMINAIAEDFGVKSCTPRDLANAIWCHFFDICTSPEWTRESVIESFDKVMDKSLKLHKRLPGGRDPEELTAVS 238
gi 71402075  141 TDSGRASTTVNEIAAALGQPKVTPAQLAELVWKHFFQMISDTALTRKILVSRFDAAMDKSLSLHRRTPTGRDPEELRALR 220
gi 71664409  141 TDSGRASTTVNEVAATLGQPKVTPAQLAELVWKHFFQMISDTALTRKILVTRFDAAMDKSLSLHRRTPTGRDPEELRALR 220
gi 74025008  143 PDGGRPSYAVNSIASVLGKGAVTPQLLAEAVWRNFFSAVADQGFKRPELIKQFEAAMDKSLVLHKRTPTGRDPMPLHALK 222
gi 154342354 159 TDAGREATMVNAIAEEFGVKSCTPQDLAKAIWHHFFDICTSPEQTRESVIESFDKVMDKSLKLHKRLPGGRDPEELTAVS 238
gi 157873157 159 TDAGREATMINTIAEDFGVKSCPPRDLANAIWCHLFDICSSPEWTRELVIESFDKVMDKSLKLHKRLPGGRDPEELTAVS 238
                        250       260
                 ....*....|....*....|....*
gi 146094843 239 LNSWGHLKVRHTDGTLEDLSAEYLF 263
gi 71402075  221 LNEWGHLIVSRPDGTEETLMAEYLF 245
gi 71664409  221 LNEWGHLIVSRPDGTEDTLMAEYLF 245
gi 74025008  223 LNEWGHLVVGRPDGSEEVLVAEYLF 247
gi 154342354 239 LNSWGHLRVRHADGTMEDLAAEYLF 263
gi 157873157 239 LNSWGHLKVRHADGTVEDLSAEYLF 263
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap