Conserved Protein Domain Family
PTZ00284

?
PTZ00284: PTZ00284 
protein kinase; Provisional
Statistics
?
PSSM-Id: 140307
View PSSM: PTZ00284
Aligned: 11 rows
Threshold Bit Score: 893.551
Threshold Setting Gi: 74025476
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71416896    1 MDSLAGNLGAARTGIQQYTVGQ-----------------ANVASGNGGKALNSARSTMTTSQSTNSARRSGSKRDRETAT 63
gi 71659275    1 MDTLAGNLGAARTGIQQYTVGQ-----------------ANVASGNGGKALNSARSTMTTSQSTNSARRSGSKRDRETAT 63
gi 71659277    4 FATRSAVLSSAQCLLPATNMNDrsyynfaargkqkpkppVNTLSSSSPKKPTQENTLQSREEEQFFSRRSGSKRDRDTAI 83
gi 71416901    4 FATRSAVLSSAQCLLPATNMNDrsyynfaasgkqkpkppVNTLSSSAPKKPTQENTLQSREEEQFFSRRSGSKRDRETAT 83
gi 74025474    1 MDSISSGLTH-RAGLQQYPSGL-----------------VNVHVNNNPKINNGACSNMTPRESTNSARRSGSKRDRETAD 62
gi 74025476   11 SSTIAKGMSGDTAGFYGSSTTAmvp-----------ppvVIASKTNHPKNQQYQSTFQADERGITHPRRSASKRDRDNGI 79
gi 154332792   4 VHTRLAPVTNIINNAYTTTAGApilrkp------emtptASTTYASSREAAVSTSHGASTNKVTATASVMVTSRG-EEAA 76
gi 146078244   5 SAAADAGGAAARSGLHVYSSAQa----------------NAAGSGTAALPNKALDHMKHMSRSKSDARRSGSKRTFDEAT 68
gi 146078248   4 LQSRLAPITNINNNAYTTTAGApilrkp------emtsaASAVYISRKEAAVSSSHGAPTNKMMATAAVTGSSRC-EEAT 76
gi 157865012   1 --------------------------------------------------------MKHMSRSKSDARRSGSKRTFDEAT 24
gi 157865014   1 ---------------------------------------------------------------MATAAVTGSGRG-EEAT 16
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71416896   64 STDITRTKSQYGEVTKKQATATTTTTstnttttttttttatagganriVEVLPLPKKKKVTYALPNQSREEGHFYVVLGE 143
gi 71659275   64 STDITRTKSQYGEVTKKQATATTTTNntttttta------tagganriVEVLPLPKKKKVTYALPNQSREEGHFYVVLGE 137
gi 71659277   84 STDITRTKSQNKAAARKSTTTTPTTNaa------------------aaVGGTAKQTKVKVTYVLPNQSREEGHFYVVLGE 145
gi 71416901   84 STDITRTKSQNKAAARKSTTTTPTTNaa------------------aaVGETAKQTKVKVTYVLPNQSREEGHFYVVLGE 145
gi 74025474   63 TADDGRNKNNQSITGTTATTTSTAKH----------------------SEMQPPPKKKKVTYALPNQSREEGHFYVVLGE 120
gi 74025476   80 EQPSAIDQSATAANNSADSAVTPKSAh--------------------gVTSYASNKKKKVTYALPNQSREEGHFYVVLGE 139
gi 154332792  77 GRRSGSKRDHEASITTDQNPQVVEVM-------------------------APPPKKKKVTYALPHQNMEEGHFYVVLGE 131
gi 146078244  69 ATDNVQLRRHDGTAVPNTAPNQVVEV------------------------VAPPPKKKKVTYALPHQNMEEGHFYVVLGE 124
gi 146078248  77 GRRSGSKRDHETSVTTDQNPQDAAKS------------------------LPPPPKKKKVTYALPHQNMEEGHFYVVLGE 132
gi 157865012  25 VTDNVQQRRHDGTAVPNTAPNQVVEV------------------------VAPPPKKKKVTYALPHQNMEEGHFYVVLGE 80
gi 157865014  17 GRRSGSKRDHETSVTTDQNPQDAAKA--------------------------LPPLKKKVTYTLPHQNMEEGHFYVVLGE 70
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71416896  144 DIDVSTQRFKILSMLGEGTFGKVVEAWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADADDRFSLMKIQRYFQN 223
gi 71659275  138 DIDVSTQRFKILSMLGEGTFGKVVEAWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADADDRFSLMKIQRYFQN 217
gi 71659277  146 DIDVSTQRFKILSMLGEGTFGKVVEAWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADADDRFSLMKIQRYFQN 225
gi 71416901  146 DIDVSTQRFKILSMLGEGTFGKVVEAWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADADDRFSLMKIQRYFQN 225
gi 74025474  121 DIDASTGRFKILSLLGEGTFGKVVEAWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMERVRLSDVEDRFPLMKIQRYFQN 200
gi 74025476  140 DIDASTGRFKILSLLGEGTFGKVVEAWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMERVRLSDVEDRFPLMKIQRYFQN 219
gi 154332792 132 DIDVSTQRFKILSLLGEGTFGKVVESWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADPADRFPLMKIQRYFQN 211
gi 146078244 125 DIDVSTQRFKILSLLGEGTFGKVVESWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADPADRFPLMKIQRYFQN 204
gi 146078248 133 DIDVSTQRFKILSLLGEGTFGKVVESWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADPADRFPLMKIQRYFQN 212
gi 157865012  81 DIDVSTQRFKILSLLGEGTFGKVVESWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADPADRFPLMKIQRYFQN 160
gi 157865014  71 DIDVSTQRFKILSLLGEGTFGKVVESWDRKRKEYCAVKIVRNVPKYTRDAKIEIQFMEKVRQADPADRFPLMKIQRYFQN 150
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71416896  224 ETGHMCIVMPKYGPCLLDWIMKHGALSHRHLAQIIFQAGTALDYFHTELRLMHTDLKPENMLLETSETVIDPVTRKATPP 303
gi 71659275  218 ETGHMCIVMPKYGPCLLDWIMKHGPLSHRHLAQIIFQVGTALDYFHTELRLMHTDLKPENMLLETSETVIDPVTRKATPP 297
gi 71659277  226 ETGHMCIVMPKYGPCLLDWIMKHGPLSHRHLAQIIFQAGTALDYFHTELRLMHTDLKPENMLLETSETVIDPVTRKATPP 305
gi 71416901  226 ETGHMCIVMPKYGPCLLDWIMKHGALSHRHLAQIIFQAGTALDYFHTELRLMHTDLKPENMLLETSETVIDPVTRKATPP 305
gi 74025474  201 ETGHMCIVMPKYGPCLLDWIMKHGPFNHRHLAQIIFQVGAALDYFHTELHLMHTDLKPENILMESGDTSVDPMTHRALPP 280
gi 74025476  220 ETGHMCIVMPKYGPCLLDWIMKHGPFNHRHLAQIIFQVGAALDYFHTELHLMHTDLKPENILMESGDTSVDPMTHRALPP 299
gi 154332792 212 DSGHMCIVMPKYGPCLLDWIMKHGPFNHRYLAQIVFQTGVALDYFHSELHLMHTDLKPENILMETSDSAVDPVTNRQLPP 291
gi 146078244 205 DSGHMCIVMPKYGPCLLDWIMKHGPFNHRHLAQIVFQTGVALDYFHSELHLMHTDLKPENILMETSDTTVDPATNRHLPP 284
gi 146078248 213 DSGHMCIVMPKYGPCLLDWIMKHGPFNHRHLAQIVFQTGVALDYFHSELHLMHTDLKPENILMETSDTTVDPATNRHLPP 292
gi 157865012 161 DSGHMCIVMPKYGPCLLDWIMKHGPFSHRHLAQIVFQTGVALDYFHSELHLMHTDLKPENILMETSDTTVDPATNRHLPP 240
gi 157865014 151 DSGHMCIVMPKYGPCLLDWIMKHGPFSHRHLAQIVFQTGVALDYFHSELHLMHTDLKPENILMETSDTTVDPATNRHLPP 230
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71416896  304 DPCRIRICDLGGCCDERHSRTAIVSTRHYRSPEVVLGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLG 383
gi 71659275  298 DPCRIRICDLGGCCDERHSRTAIVSTRHYRSPEVVLGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLG 377
gi 71659277  306 DPCRIRICDLGGCCDERHSRTAIVSTRHYRSPEVVLGLGWMYSTDMWSMGCIIYELCTGKLLYDTHDNLEHLHLMEKTLG 385
gi 71416901  306 DPCRIRICDLGGCCDERHSRTAIVSTRHYRSPEVVLGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLG 385
gi 74025474  281 EPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVVLSLGWMYSTDLWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLG 360
gi 74025476  300 EPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVVLSLGWMYSTDLWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLG 379
gi 154332792 292 DPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVILGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLC 371
gi 146078244 285 DPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVILGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLG 364
gi 146078248 293 DPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVILGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNLEHLHLMEKTLG 372
gi 157865012 241 DPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVILGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNAEHLHLMEKTLG 320
gi 157865014 231 DPCRVRICDLGGCCDERHSRTAIVSTRHYRSPEVILGLGWMYSTDMWSMGCIIYELYTGKLLYDTHDNAEHLHLMEKTLG 310
                        410       420       430       440       450       460       470       480
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71416896  384 RLPQEWAGRCGTEEARQLYNSVAQLRPCTDPKHLARIARARPVREVISDKLLCDLIYGLLHYDRQKRLTARQMTTHQYVL 463
gi 71659275  378 RLPQEWAGRCGTEEARQLYNSVAQLRPCTDPKHLARIARARPVREVISDKLLCDLIYGLLHYDRQKRLTARQMTTHQYVL 457
gi 71659277  386 RLPQEWAGRCGTEEARQLYNSVAQLRPCTDPKHLARIARARPVREVISDKLLCDLIYGLLHYDRQKRLTARQMTTHQYVL 465
gi 71416901  386 RLPQEWAGRCGTEEARQLYNSVAQLRPCTDPKHLARIARARPVREVISDKLLCDLIYGLLHYDRQKRLTARQMTTHQYVL 465
gi 74025474  361 RLPADWSVRCGTQEARDLFTAAGTLQPCKDPKHIARIARARPVREVITEPLLCDLILNLLHYDRQRRLNARQMMSHAYVH 440
gi 74025476  380 RLPADWSVRCGTQEARDLFTAAGTLQPCKDPKHIARIARARPVREVITEPLLCDLILNLLHYDRQRRLNARQMMSHAYVH 459
gi 154332792 372 RLPSEWATRCGTEEARLLYSSTGHLRPCTDPKHLARVARARPVRDVIRDDLLCDLIHGLLHYDRQKRLNARQMTTHPYVL 451
gi 146078244 365 RLPSEWAARCGTEEARLLYNSAGQLRPCTDPKHLARIARARTVRDVIRDDLLCDLIYGLLHYDRQKRLNARQMTTHPYVL 444
gi 146078248 373 RLPSEWAARCGTEEARLLYNSAGQLRPCTDPKHLARIARARTVRDVIRDDLLCDLIYGLLHYDRQKRLNARQMTTHPYVL 452
gi 157865012 321 RLPSEWAARCGTEEARLLYNSAGQLRPCTDPKHLARIARARTVRDVIRDDLLCDLIYGLLHYDRQKRLNARQMTTHPYVL 400
gi 157865014 311 RLPSEWAARCGTEEARLLYNSAGQLRPCTDPKHLARIARARTVRDVIRDDLLCDLIYGLLHYDRQKRLNARQMTTHPYVL 390
                        490       500
                 ....*....|....*....|....*
gi 71416896  464 KYYPECRQHPNYPDNRPSLRPTPLM 488
gi 71659275  458 KYYPECRQHPNYPDNRPTLRPTPLM 482
gi 71659277  466 KYYPECRQHPNYPDNRPSLRPTPLM 490
gi 71416901  466 KYYPECRQHPNYPDNRPSLRPTPLM 490
gi 74025474  441 KYFPECRQHPNHVDNRSKLPPTPVM 465
gi 74025476  460 KYFPECRQHPNHVDNRSKLPPTPVM 484
gi 154332792 452 KYYPEARQAPSYPDNRSMLRPPPIM 476
gi 146078244 445 KYYPEARQAPSYPDNRAMLRPPPIM 469
gi 146078248 453 KYYPEARQAPSYPDNRAMLRPPPIM 477
gi 157865012 401 KYYPEARQAPSHPDNRSMLRPPPIM 425
gi 157865014 391 KYYPEARQAPSHPDNRSMLRPPPIM 415
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap