Conserved Protein Domain Family
PTZ00285

?
PTZ00285: PTZ00285 
glucosamine-6-phosphate isomerase; Provisional
Statistics
?
PSSM-Id: 140308
View PSSM: PTZ00285
Aligned: 10 rows
Threshold Bit Score: 463.46
Threshold Setting Gi: 159117739
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159117739   1 MTVCVAQAERGASELESKAMVKKSNDaallvaHriaeVVRSKPNCVLGLATGSTPIPVYQELARLHREEGLDFSQVRTFN 80
gi 66828881    1 MRLIIKNDSCEAGEYISQVIKKRIND------YflnrKSGDNRPFVIGLPTGSSPLPIYKRLIEMNKNKEISFQEVVTFN 74
gi 71411196    1 MRIVISQDSDAVADYVASYIVDRIHD------F----SPSKERPFVLGLPTGGTPVRTYQRLIQAYREGRVSFRNVVTFN 70
gi 71422938    1 MRIVISQDSDAVADYVASYIIDRIHD------F----SPSKERPFVLGLPTGGTPVRTYQRLIQAYREGRVSFRNVVTFN 70
gi 74026336    1 MRIVISPDDEAVADYVSEYIIKKIID------F----GPSSERPFVIGLPTGSSPLKTYQRLVKAYRDGRISFRNVVTFN 70
gi 146097045   1 MRIVISETADKVADYTSNYVIKSIND------F----KPTADRPFVLGLPTGETPMRTYQKLIVAYREGRVSFKNVITFN 70
gi 154343521   1 MRIVISETADQVADYASKYVIASIND------F----KPTEDRPFVLGLPTGETPMRTYQKLIVAYREGRVTFKNVVTFN 70
gi 157874337   1 MRIVISETAEKVADYTSNYVIKSIND------F----KPTEDRPFVLGLPTGETPMRTYQKLIVAYRKGRVSFKNVITFN 70
gi 167535579   1 MRLYIYENKDQVGCWTANYIVRRIND------F----GPTADKPFVLGLPTGSTPLPTYRELIKLYQDKKVSFEHVITFN 70
gi 159117647   2 PSIHVSKCADPAIK-----LAHRIAE-----------VVRSKPNCVLGLATGSTPIPVYQELARLHREEGLDFSQVRTFN 65
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159117739  81 LDEYAGLPPTHDQSYRFFMEEHLFSKVNIKPENVHFLSGLAIRAEDECIRYENALQTIGPCDVWLL-------------- 146
gi 66828881   75 MDEYVGLESNHKFSYHYFMWENFFNHIDIKKENINILNGTTDNHENECKLYEEKIQSYGGIDLFLG-------------- 140
gi 71411196   71 MDEYVGLPREHPQSYFYFMKTNFFDFVDIPEENRNLLDGTVPDLIQECRRYEDKIRQVGGIHLFLA-------------- 136
gi 71422938   71 MDEYVGLPREHPQSYFYFMKTNFFDFVDIPEENRNLLDGTVPDLIQECRRYEDKIRQVGGIHLFLA-------------- 136
gi 74026336   71 MDEYVGLPRDHPQSYYYFMKHNFFDHVDIPEQNRNLLNGTAADLVAECRMYEEKIAAVGGVELFLA-------------- 136
gi 146097045  71 MDEYVGLPADHPESYHYFMKHNFFDYVDIPEQNRHILNGNAPDLIEECRQYEEKIRAVGGIQLFLA-------------- 136
gi 154343521  71 MDEYVGLPADHPESYHYFMKHNFFNYVDIPEKNRHILNGNAPDLIEECRQYEEKIKAAGGIHLFLA-------------- 136
gi 157874337  71 MDEYVGLPADHPESYHYFMKHNFFDYVDIPEQNRHILDGNAPDLIEECRQYEEKIRAVGGIHLFLA-------------- 136
gi 167535579  71 MDEYVGLPRDHPESYHSFMWTNFFKHVDIKPENAHILNGNADDLKAECAAFEAKIHAVGGIELFLAgiskthrvqntclk 150
gi 159117647  66 LDEYAGLPPTHDQSYRFFMEEHLFSKVNIKPENVHFLNGMASDYEKECERYEQELKAIGPCDVWLL-------------- 131
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 159117739 147 ----------------------GIGHNGHIAFNEPGSPRDSRTRVVCLTQSTIDANARFFgNDKSKVPTKALSVGIATIM 204
gi 66828881  141 ----------------------GMGVDGHIAFNEPGSSLSSRTRIKTLTRDTIIANSRFF-NNINQVPTQALTVGVGTIM 197
gi 71411196  137 ----------------------GIGTDGHIAFNEPGSSLDSVTRVKSLNDETIASNARFFnNDIRKVPTMALTVGIRTVM 194
gi 71422938  137 ----------------------GIGTDGHIAFNEPGSSLDSVTRVKSLNDETVASNARFFnNDIRKVPTMALTVGIRTVM 194
gi 74026336  137 ----------------------GVGTDGHLAFNEPGSSLESLTRVKSLNQETITSNARFFdNDIRKVPTMALTVGIRTVM 194
gi 146097045 137 ----------------------GIGTDGHLAFNEPGSSLYSRTRVKSLNAETMESNARFFgNDVSRVPTMALTVGLRTIM 194
gi 154343521 137 ----------------------GIGTDGHLAFNEPGSSLYSHTRVKSLNAETMKSNARFFgNDVSRVPTMALTVGLRTIM 194
gi 157874337 137 ----------------------GIGTDGHLAFNEPGSSLYSRTRVKSLNAETMESNARFFgNDVSRVPTMALTVGLRTIM 194
gi 167535579 151 trsplirapyprtlvvamprplGIGPDGHIAFNEPGSSLASRTRIKTLAYDTIVANARFFdNDITKVPHMALTVGVGTVM 230
gi 159117647 132 ----------------------GIGHNGHIAFNEPGSPRDSRTRVVCLTQSTIDANARFFgNDKSKVPTKALSVGIATIM 189
                        250       260       270       280       290
                 ....*....|....*....|....*....|....*....|....*....|....*....
gi 159117739 205 ESREILLLATGESKCEAVTKAIVGEPTNAVPASLLQRHPRCCFYVDEAAGAEVAETVTE 263
gi 66828881  198 DAREIILIVTGHSKAIALYRTIEEGVNHMWTASAIQMHKKSIIVCDEDATAELKVKTYK 256
gi 71411196  195 QAKSVLVIATGSKKAIAVARCVEGSVTHVHPITALQLHPSAVLCLDEDATLELKVKTVK 253
gi 71422938  195 QAKSVLVIATGSKKAIAVARCVEGSVSHVHPITALQLHPSAVLCLDEDATLELKVKTVK 253
gi 74026336  195 NARNVVVVATGAGKAVPVAHCVEGSVTHAHPITALQLHPAAVLCVDEDATLELKVKTVR 253
gi 146097045 195 EAKVVLMIATGASKALAVARCVEGGITHMCTATMLQMHPAAVLCLDEDATLELKVRTTR 253
gi 154343521 195 DAKVVLMMATGASKALAVARCVEGGITHMCTATMLQMHPAAVLCLDEDATLELKVRTTR 253
gi 157874337 195 EAKFVLMMATGAGKALAVARCVEGGITHMCTATMLQMHPAAVLCLDEDATLELKVRTTR 253
gi 167535579 231 DAREVCLLVTGVHKSFALHKAIEEGVNHMWTCSALQNHPNAVVVCDEDATMELKVKTVK 289
gi 159117647 190 ESREILLLATGESKREAVTKSVKGKCETHCPASFLHEHPHCRFYVDMDAGKEVDNTCCQ 248
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap