Conserved Protein Domain Family
PTZ00297

?
PTZ00297: PTZ00297 
pantothenate kinase; Provisional
Statistics
?
PSSM-Id: 140318
View PSSM: PTZ00297
Aligned: 7 rows
Threshold Bit Score: 2752.8
Threshold Setting Gi: 71755785
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976    1 MSASDIGCASARVLSYNFNILPRGSGGYQHERIETFLASVDAYDVVLLQEVYATSYFPYVMQKQLCYQKMLLDGLKAKGF 80
gi 71653816    28 TPNMEAGSMQVRALSYNFNILPRGCGGFQNERIDNFLKCVNEYDVLLFQEVYAASVLPYFVQKHICFQKRLVDELKERGF 107
gi 71650128    28 TPNMEAGSTQVRALSYNFNILPRGCGGFQNERIDNFLKCVNEYDVLLFQEVYAASVLPYFVQKHICFQKRLVDELKERGF 107
gi 71755785    25 IAVATATNAQLRVLSYNFNILPRGCGGFQRERISSFLETVDQYDVIMLQEVYAASVLPYFLQNRMCFQKMLVDELVLRGF 104
gi 146091517    1 MSASDIGCASARVLSYNFNILPRGSGGYQHERIETFLASVDAYDVVLLQEVYATSYFPYVMQKQLCYQKMLLDGLKAKGF 80
gi 154340187    1 MPTNDGGCASARVLSYNFNILPRGSGGYQHERIETFLASIDAYDVVLLQEVYATSYFPYVLQKQLCYQKMLLDGLKAKGL 80
gi 157871486    1 MSASDVGCASARVLSYNFNILPRGSGGYQHERIETFLASVDGYDVVLLQEVYATSYFPYVMQKRLCYQKMLLDGLEAKGF 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976   81 HHYVISRQPSYLTMLRYNVCSDNGLIIASRFPVWHRGSYTFRNHERGEATVSKGCLFAEVEVPAAQGkGSQRIVFFNVHL 160
gi 71653816   108 THYVISKQPSYPTIFRHNVHSDNGLIIASRFPIEQCGSYTFGCNKRGSQSVRRGCLFAEVMVPLREG-GSVPILFFNVHL 186
gi 71650128   108 THYVISKQPSYPTIFRHNVHSDNGLIIASRFPIEQCGSYTFGCNKRGSQSVRRGCLFAEVMVPLREG-GSVPILFFNVHL 186
gi 71755785   105 QHYAISKQPSYTTMLRNNVFSDNGLIIASRFPIGQRGSYTFRSHERAVQSVRRGCLFAEVKVPLTSG-GEESIIFFNVHL 183
gi 146091517   81 HHYVISRQPSYLTMLRYNVCSDNGLIIASRFPVWHRGSYTFRNHERGEATVSKGCLFAEVEVPAAQGkGSQRIVFFNVHL 160
gi 154340187   81 HYYVISRQPSYLTMLRYNVCSDNGLIIASRFPIWHRGSYTFRNHERGEATVSKGCLFAEVEVPAAHGeGSQRIVFFNVHL 160
gi 157871486   81 HHYVISRQPSYLTMLRYNVCSDNGLIIASRFPVWHRGSYTFRNHERGEATVSKGCLFAEVEVPAAHGkGSQRIVFFNVHL 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976  161 RPEDNLPSESSQMQQVHRFVEAALAQVQEQRTDgdelaalqqkGAEVPFIIAGDFNIHGIDPLN-GHPSKRFQEMLNQFQ 239
gi 71653816   187 RQDESTVATFSQVMETRRFIDSVISNLYGENNE----------ASKIPLVVAGDFNINGIDPHNgGKPTKIFMELMQELQ 256
gi 71650128   187 RQDESAVATFSQVMETRRFIDSVIGNLYAENNE----------ASKIPLVVAGDFNINGIDPHNgGKPTKIFMELMQELQ 256
gi 71755785   184 RQEDSDDVTSEHVKETRQFAASVIRNMCSNPED----------VAQIPFVLAGDFDVNGINLHNvGQPTKKYEDLLGELQ 253
gi 146091517  161 RPEDNLPSESSQMQQVHRFVEAALAQVQEQRTDgdelaalqqkGAEVPFIIAGDFNIHGIDPLN-GHPSKRFQEMLNQFQ 239
gi 154340187  161 RPQDNLPSESSQMQQVHRFVEAALTQVREQHNGnnapgvrqrkGAEVPFIIAGDFNIYGIDPVT-GHSSKRFQEMLNQFQ 239
gi 157871486  161 RPEDNLPSESSQMQQVHRFVEAALAQVREQHADgggpaalqpkGAEVPFIIAGDFNIHGIDPLN-GHPSMRFQEMLNQFQ 239
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976  240 DIGS-VRDVIYEETGQNPPTRPPILFFPELSKLERYESTPQRQDYFLATTCIQVEKPRLEKYVVSSRRPYTYLSDHFGIT 318
gi 71653816   257 PLGGgLSEVILDTHGYHPSTRPSKLFFPSQSKLNRDSLTPQRQDFFFVTPAVDVRMACIKKFIASSRSPYVYLSDHFGVS 336
gi 71650128   257 PLGGgLSEVILDTHGYHPSTRPSKLFFPSQSKLNRESLTPQRQDFFFVTPAVDVRMACIKKFIASSRSPYVYLSDHFGVS 336
gi 71755785   254 ALGSgVREAVFDAQHRHPPTRPTELFFPTQSKLVRNSFSPQRQDYFFVSHTVAVKNPDIHKFVSDSQQPYTYLSDHFGVS 333
gi 146091517  240 DIGS-VRDVIYEETGQNPPTRPPILFFPELSKLERYESTPQRQDYFLATTCIQVEKPRLEKYVVSSRRPYTYLSDHFGIT 318
gi 154340187  240 DIGS-VRDVIYEETGQNPPTRPPILFFPELSKLERYESTPQRQDYFLAEARIQVEKPHLEKYVVSRRRPYTYLSDHFGIT 318
gi 157871486  240 DIGS-VRDVIYEETGQNPPTRPPILFFPELSKLERYESTPQRQDYFLATKCIQVEKPRLEKYVVSSRRPYTYLSDHFGIA 318
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976  319 CRVTLALNPSVSFEGRSLLRLNFSSLVEAANHEHSNPSSDARLEAVLIAAFVWWLFSFSFMSLVLCAAfAWLVRWAQNYS 398
gi 71653816   337 ATLCVSASDQRIPHKNSTRPLLKTSMSRGIVHEHSNPLLSMKMQFIPLLLTAWAAMYFNSLTLCVLGA-VWFLLWCFVSR 415
gi 71650128   337 ATLCVSASDQRIPHKNSTRPLLKTSMSRGIVHEHSNPLLSMKMQFIPLLLTAWAAMYFNSLTLCVLGA-VWFLLWCFVSR 415
gi 71755785   334 AVLAIPQTSKQRHKRWMPLTESNAPESEETVNEHSNPIFSIIVEIIVLCTVSWAAFCFSWVALLFSLL-VGVLVWYCLSP 412
gi 146091517  319 CRVTLALNPSVSFEGRSLLRLNFSSLVEAANHEHSNPSSDARLEAVLIAAFVWWLFSFSFMSLVLCAAfAWLVRWAQNYS 398
gi 154340187  319 CRVTLPLNERDNFQARSYSRLNVSSLVEAANHEHSNPTSDARLEAVLIAVLAWWLFSFSFTSLMLCAAlVWLVRWAQHYS 398
gi 157871486  319 CRVTLALNPSVCFEGRSLVRLNFSSLVEAANHEHSNPSSDARLEAVLIAAFVWWLFSFSFMSLVLCAAfAWLVRWAQNYS 398
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976  399 ASPVLSEPPLLTMEALKEKGEMCFA---NSSLNPLAGVRTLGEMWERSVTRFRTFKCLGATSEVGESEWMTYGTVDVRAR 475
gi 71653816   416 IHALSNERQFATVRSAVVEGKEAVTlnqPKEYKTLQGVKSLAELWQKTVQHHSMLRCLGQNKESGESEWLTYADVDAKVR 495
gi 71650128   416 IHALNNERQFATVRSAVVEGKEAVTlnhPREYKTLQGVKSLAELWQKTVQHHSMLRCLGQNKESGESEWLTYADVDAKVR 495
gi 71755785   413 IHELRSERKFTRVGNSNAHGGEGCVsdlPREYESLKHANSVGEMWRRAVSLHSAQRCLGQKNDAGVPEWLTFVSVDARAQ 492
gi 146091517  399 ASPVLSEPPLLTMEALKEKGEMCFA---NSSLNPLAGVRTLGEMWERSVTRFRTFKCLGATSEVGESEWMTYGTVDVRAR 475
gi 154340187  399 ASPVLGEPPLLTMEALKEKGDMCFA---NTAFNPLAGVRTLGEMWERSVARFRTFKCLGATSELGEPEWITYGTVDIRAR 475
gi 157871486  399 ASPVLSEPPLLTMEALKEKGEMCFA---NKALNPLAGVRTLGEMWERSVTRFRTFKCLGATSELGEPEWMTYGTVDIRAR 475
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976  476 ELGAGLLEMGFRAGDLIGVACEPCRNIVILEVACALYGFTTVPLAGKRSTMSALLDRHKIRVAVGDRSSVAMLLTCRSTK 555
gi 71653816   496 ELGSGLCALGVVPGDVIGVDCQANREAVILEIACVMYGFTTLTLVGRGNAFRTLIDEHNVKVVFASRNNVASILTCRSRH 575
gi 71650128   496 ELGSGLCALGVVPGDVIGVDCQANREAVILEIACVMYGFTTLTLVGRGNAFRTLIDEHNVKVVFAGRNNVASILTCRSRH 575
gi 71755785   493 ELASGLAALGVGPGDVIGVDCDASVDSTVLELACATYGIATLALVGKGSTIRNLIDEYDIKVVFAARNAVGAILTCRSRS 572
gi 146091517  476 ELGAGLLEMGFRAGDLIGVACEPCRNIVILEVACALYGFTTVPLAGKRSTMSALLDRHKIRVAVGDRSSVAMLLTCRSTK 555
gi 154340187  476 ELGAGLLKMDFRAGDLIGVACEPSRSIVILEVACALYGFTTVPLAGKRSTMRTLLDRHKIRVAVGDRNSVVALLTCRSTK 555
gi 157871486  476 ELGAGLLEMGFRAGDLIGVACEPCRNIVILEVACALYGFTTVPLAGKRSTMSALLDRHRIRVAVADRSSVAMLLTCRSTK 555
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976  556 LEAVMYTSAFADEDDHATAKDLNIRLIPFEFVEQKGRLCPVaPAKEHVTTDSVFTYTLDNTNSlASDDGSALLPVRHSSV 635
gi 71653816   576 LETVVNVHSFYDAEDDAVARDFGITLLLYDGVCYNGRLRLV-PPPLHVASETVFSLVVDTTTT-NMGSSLSVVRMTHADV 653
gi 71650128   576 LETVVNVHSFYDAEDDAVARDFGITLLLYDGICYNGRLRLV-PPPLHVASETVFSLVVDTTTT-NLGSSLSVVRMTHADV 653
gi 71755785   573 LETLVCMHSSHDSTDCMVARDVCITLISYNEVFSKGRSQPV-LLRPVCDDTTLYTMVVDPSTS---NGNLKVVRVTHADA 648
gi 146091517  556 LEAVMYTSAFADEDDHATAKDLNIRLIPFEFVEQKGRLCPVaPAKEHVTTDSVFTYTLDNTNSlASDDGSALLPVRHSSV 635
gi 154340187  556 LEAVLYTSAFVDESDHAAAKDLNIRLIPFEFVEQKGRLSPVaPLKEHVTTDSVFTYTMDNTDSvACGDESALLPVRHSTI 635
gi 157871486  556 LEVVMYTSAFVDEDDHATAKDVNIRLIPFEFVEQKGRLCPVaPAKEHVTTDSVFTYTLDNTNSlASDDGSALLPVRHSSV 635
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976  636 LYDLSLLLMTGVLPSSFKGESMVWFSPMALLFHRVCVLGMLSQGNAIATVDAAHlQEAFVKFQPTLLVTAPTLFSTSRLQ 715
gi 71653816   654 LRDICTLVATSVLPTSRKKHLVVHFTPFSMVFNRIFVLGLFAHGSSVATSEGAS-RRAFTVFRPTIMLAVPSLFATSETQ 732
gi 71650128   654 LRDICTLVATSVLPTSRKKHLVVHFTPFSMVFNRIFVLGLFAHGSSVATSEGAS-RRAFTVFRPTIMLAVPSLFATSETQ 732
gi 71755785   649 LRAIRTLVGTAVLPNTQHKHLLVHYTPFAMLFNRLFVLGLFAHGSAVATTPVAAcARAFATIQPTIVVATPSLFSTSAVQ 728
gi 146091517  636 LYDLSLLLMTGVLPSSFKGESMVWFSPMALLFHRVCVLGMLSQGNAIATVDAAHlQEAFVKFQPTLLVTAPTLFSTSRLQ 715
gi 154340187  636 LYDLSLLLMTGVLPSSFKGESMVWFSPMALLFHRVCVLGMLSQGNAIATVDAAHlQEAFVKFHPTLLVTSPALFSTSRLQ 715
gi 157871486  636 LYDLSLLLMTGVLPSSFKGESMVWFSPMALLFHRVCVLGMLSQGNAIATVDAAHlQEAFVKFQPTLLVTAPTLFSTSRLQ 715
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976  716 LSRAQHRHSAVYNWFFNRTFQLRSRLIHIKRQDSSLLRFMFFRAFQEQLGGRVRKIILSVSQESTAFSLLEHVSVCYVPL 795
gi 71653816   733 LKRKNERYGCVYSWLFEKAFQLRSVLINVHRRDSPVLRLIFFRSTQRLLGGCVEKVVLCVSEESTSYRLEEHIAVCYAPC 812
gi 71650128   733 LKRKNERYGCVYSWLFEKAFQLRSVLINVHRRDSPVLRLIFFRSTQRLLGGCVEKVVLCVSEESTSYRLEEHIAVCYAPC 812
gi 71755785   729 LRRRNERYWPIFSWIFEQIYHLRLFLINTHNRDSLILRTIFFRGTQHLFGGNVEKIVVCSSEESLSDTLAEHIVVCYTPC 808
gi 146091517  716 LSRAQHRHSAVYNWFFNRTFQLRSRLIHIKRQDSSLLRFMFFRAFQEQLGGRVRKIILSVSQESTAFSLLEHVSVCYVPL 795
gi 154340187  716 LSRAQHRHSSVYNWFFNRAFQLRSRLIHLKRQDSSLLRFIFFRAFQEQLGGCVRKIILSVSQESTTFSLLEHISVCYVPL 795
gi 157871486  716 LSRAQHRHSAVYNWLFNRAFQLRSRLIHIKRQDSSLLRFIFFRAFQEQLGGRVRKIILSVSQESTAFSLLEHVSVCYVPL 795
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976  796 VCEVSYLNCFGVCAIDGTTAPSLQVDLEPINDLSDGVGIGQLVIAKKGePRRRLEIAAQWKRDGTVKFLGEPLGILWPVA 875
gi 71653816   813 LREVFFIPSEGVFCVDGIPAPGVRVELEPFDEPSTKNTFGQLTLLRRS-AKHTLPIAAKWNDQRTLRLMGPPGGILLPLK 891
gi 71650128   813 LREVFFIPSEGVFCVDGIPAPGVRVELEPFDEPSTKNTFGQLTLVRHS-AKHTLPIAAKWNDQRTLRLMGPPGGILLPLK 891
gi 71755785   809 LREVFFLPSEGVFCVDGVPAPNIHVHLEPFDEPSKEAKIGSLVLSCEGrKERTLPIAAMWTGTRTLRLIGPPDGVLLPVR 888
gi 146091517  796 VCEVSYLNCFGVCAIDGTTAPSLQVDLEPINDLSDGVGIGQLVIAKKGePRRRLEIAAQWKRDGTVKFLGEPLGILWPVA 875
gi 154340187  796 VCEVSYLNCVGVCTIDGTPAPSMQADLEPISDLSNSAGIGQLVITKKGePRRRLEIAAQWKRDGTAVFLGAPLGILWPVA 875
gi 157871486  796 VCEVSYLNCLGVCAIDGMTVPSLQVDLEPISDLSDGVGIGQLVIAKKGePRRRLEIAAQWKRDGTAKFLGEPLGILWPVA 875
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976  876 YQYAIAAELERIFSVSRYINAIFVYCDPLKPIIAVVYPNRDTIEFEWRQSHC----------CDGPARQLGWTDLVAYAT 945
gi 71653816   892 GEYVVAAELERIFAQSRYVNDIFLYARPSRPIIAIVSPNRDTVEFEWQQQHSmgvnnngeaeGGAGSASLSWTELSRYAS 971
gi 71650128   892 GEYVVAAELERIFAQSRYVNDIFLYARPSRPIIAIVSPNRDTVEFEWQQQHSmgvnnngeaeGGAGSASLSWTELSRYAS 971
gi 71755785   889 SEYVLAASLERVFSQSRYVNDVFLYAEPSRPIIAIISPNRDTVDFEWRQSREge-------vAGEDNLLSNWAKFASFAS 961
gi 146091517  876 YQYAIAAELERIFSVSRYINAIFVYCDPLKPIIAVVYPNRDTIEFEWRQSHC----------CDGPARQLGWTDLVAYAT 945
gi 154340187  876 YQYAIAAELERIFSVSRYVNAIFVYCDSLKPIIAVVYPNRDTIEFEWHLSHG----------GDGPARQLGWKELVEYAM 945
gi 157871486  876 YQYTIAAELGRIFSVSRYINAIFVYCDPLKPIIAVVHPNRDTIEFEWRQSHC----------CDDPARQLGWTELVAYAT 945
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976  946 SIITADLACIAREEQLHPSQVPEFVHLHPHAFSDHSTFLTPFGKIRRDAVHKYFSSVFERLYSGVATSPLAALTADLQED 1025
gi 71653816   972 GLLLADFSCIAKLNGLQASNVPEYVHPHPHSFKDHGNFFTPYGKLRRDCVTRYFTSVIERFYSDTESTFSPTPCYTSSGN 1051
gi 71650128   972 GLLLADFSCIAKLNGLQASNVPEYVHPHPHSFKDHGNFFTPYGKLRRDCVTRYFTSVIERFYSDTESTFSPTPCYTSSGN 1051
gi 71755785   962 DLLTADFQVIAKRNALHESNVPSYVHIHPHAFKKHDSFLTPYGGIRRNSLKSYFKVVIEGFYNDATPTALPTPGQIIESD 1041
gi 146091517  946 SIITADLACIAREEQLHPSQVPEFVHLHPHAFSDHSTFLTPFGKIRRDAVHKYFSSVFERLYSGVATSPLAALTADLQED 1025
gi 154340187  946 SIISADLASIAGEAHLHPSQIPEFVHLYPHAFSDHSTFLTPFGKIRRDAVHSYFSSVFERLYNGSETLPLAALSVDWQED 1025
gi 157871486  946 SIITADLASIAREEKLHPSQVPEFVHLHPHAFSDHSTFLTPFGKIRRDAVHKYFSSVFERLYSGVATSPLAALSADLPED 1025
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976 1026 VSDVESSGTkLGSICDFDLRVPVTIDIGGTFAKIAFIMPPTGGAFPTFpsIIHEASSLSEKLGLRTFYFFADEEAAESEL 1105
gi 71653816  1052 SSDIDCAGT-LSHDQQFSLQVPAAIDIGGSFAKFLYVQPPGFFEIPDY--MVHESSSLSERLGLRTFHFFADAPVLEEQP 1128
gi 71650128  1052 SSDIDCAGT-LSHDRQFSLQVPAAIDIGGSFAKFLYVQPPGFFEIPDY--MVHESSSLSERLGLRTFHFFADAPVLEEQP 1128
gi 71755785  1042 ----EEGQAyERDQKPFSLNTPISIDVGGTFAKLVYVQPPGDFKVPHY--VVKEAAVLAEGFNVRMLDLLDNAEGMKRLL 1115
gi 146091517 1026 VSDVESSGTkLGSICDFDLRVPVTIDIGGTFAKIAFIMPPTGGAFPTFpsIIHEASSLSEKLGLRTFYFFADEEAAESEL 1105
gi 154340187 1026 VSDAESSVTrVSSMCSFDLQVPVTIDIGGTFAKIAFVMPPMTDTLPTFpsIIHEASSLSEKLGVRTFHFFAGEEAANNEL 1105
gi 157871486 1026 VSDVESSGTkLGSVCDFDLRVPVTIDIGGTFAKIAFIMPPTGGAFPTFpsIIHEASSLSEKLGLRTFQFFADEEAAESEL 1105
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976 1106 RTRSHSRVGTLRFLKIPSQQVPRFADYLAGSHAINNFKPQYTTKVRATGGGAFKYASVARNVLGIEFDVVKEMDAVVKGL 1185
gi 71653816  1129 QGLRSSSVGTVRFAKVPSKRIPDFVAYLEKNKPHNFYAEAFRKSIRATGGGAFKYASIAKKRLHVSFEVMREMDSVVHGL 1208
gi 71650128  1129 QGLRSSNVGTVRFAKVPSKRIPDFVAYLEKNKPHNFYAEKFRKSIRATGGGAFKYASIAKKRLHVSFEVMREMDSVVQGL 1208
gi 71755785  1116 NDDPFSTVGTLQFAKMSSKCIPDFMSYIVESQMLSYYTKEYRNTLRVTGGGAFKYAALAKK-MDLNFSVMREMSAVVHGL 1194
gi 146091517 1106 RTRSHSRVGTLRFLKIPSQQVPRFADYLAGSHAINNFKPQYTTKVRATGGGAFKYASVARNVLGIEFDVVKEMDAVVKGL 1185
gi 154340187 1106 RTRPHSRVGTLRFLKIPSQQIPRFADYLASIHAIKYFKPQYTTQVRATGGGAFKYASTARSVLGINFSVVREMDAVVKGL 1185
gi 157871486 1106 RTRSHSLVGTLRFLKIPSQQVPRFTDYLAGSHAINNFKPQYTTKVRATGGGAFKYASVARNVLGIEFDVVKEMDAVVKGL 1185
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976 1186 NLVLRVAPESVFTVDPSTGVHHPHQLVS-NGDGFSPFPYLLINIGSGISFIKCTGADGSHVRVGGSPIGGATFWGLIRTM 1264
gi 71653816  1209 TLLIRSAPWSIFTVDPTTGIHYPHKLRSpPGDTLSPFPCLLVNIGSGISIIKCLGPDGSHVRVGGSPIGGATFWGLVRTM 1288
gi 71650128  1209 TLLIRSAPWSIFTVDPTTGIHYPHKLQSpPGDTLSPFPCLLVNIGSGISIIKCLGPDGSHVRVGGSPIGGATFWGLVRTM 1288
gi 71755785  1195 GVVIGRAPETIFTVDPATGERHPHRLKSpPGEPFSPYPCLLVNIGSGISIIKCLGPDGSHVRIGGSPMGGATFWGLVRTM 1274
gi 146091517 1186 NLVLRVAPESVFTVDPSTGVHHPHQLVS-NGDGFSPFPYLLINIGSGISFIKCTGADGSHVRVGGSPIGGATFWGLIRTM 1264
gi 154340187 1186 NLVLRIAPESVFTVDSITGVHQPHQLVS-SGDGFSPFPYLLINIGSGISFIKCTGADGSHVRVGGSPIGGATFWGLIRTM 1264
gi 157871486 1186 NLVLRVAPESVFTVDPSTGVHHPHQLVS-NGDGFSPFPYLLVNIGSGISLIKCTGADGSHVRVGGSPIGGATFWGLIRTM 1264
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976 1265 TNLTSWEEVMEIMRLDGPGDNKNVDLLVGDIYGYNAKDLPAMLSSETVASTFGKLGTERFYDMRRSVCTAHFADDDAaGE 1344
gi 71653816  1289 TDVTSWEEVLEIMRLDGPGDNKNVDLLVGDIYGYNAHDLPAMLSVDTVASSFGKLGADRFYEAMAGGSLRRNSGDDN-GN 1367
gi 71650128  1289 TDVTSWEEVLEIMRLDGPGDNKNVDLLVGDIYGYNAHDLPAMLSVDTVASSFGKLGADRFYEAMAGGSLRRSSGDDN-GD 1367
gi 71755785  1275 TAVTSWEEITETMRLDGPGDNRNVDLLVGDIYGYNAKDLPPMLSVDTVASTFGKLGTERFYESQGNVDRLYASSSEDlSG 1354
gi 146091517 1265 TNLTSWEEVMEIMRLDGPGDNKNVDLLVGDIYGYNAKDLPAMLSSETVASTFGKLGTERFYDMRRSVCTAHFADDDAaGE 1344
gi 154340187 1265 TNLTSWEEVIEIMRLDGPGDNKNIDLLVGDIYGYNANDLPAMLFSETVASTFGKLGTERFYDLSRGDSTTHFADDDAtGE 1344
gi 157871486 1265 TNLTSWEEVMEIMRLDGPGDNKNVDLLVGDIYGYNAKDLPAMLSSETVASTFGKLGTERFYDMKRNICTAHFADDDAaGE 1344
                        1370      1380      1390      1400      1410      1420      1430      1440
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146095976 1345 ILSPkaLKTPSVISEL-PVRNGTKAASAIDIVRSLLNMISSNVTQLAYLHARLHGVPNIFFAGGFVRDNAMIWSLISTTM 1423
gi 71653816  1368 VISP--LPSPTVSSPT-SLWKGKTKPSAIDIVRSLLNMISANITQLAYLHSRVQNVENIFFAGGFVRDNPIIWSHISSTL 1444
gi 71650128  1368 VISP--LPSPTVSSPT-SLWKGKTKPSAIDIVRSLLNMISANITQLAYLHSRVQNVENIFFAGGFVRDNPIIWSHISSTL 1444
gi 71755785  1355 AVSSspDSNPTLHDAVaPTLASHGKTSEIDIVRSLLNMISSNVTQLAYLHSRVQDVHNIFFAGGFVRNNPIVWSHISSFM 1434
gi 146091517 1345 ILSPkaLKTPSVISEL-PVRNGTKAASAIDIVRSLLNMISSNVTQLAYLHARLHGVPNIFFAGGFVRDNAMIWSLISTTM 1423
gi 154340187 1345 ILSPkaSKASSMVSKR-PARNGTKAASAIDIVRSLLNMIASNVTQLAYLHARLHGVPNIFFAGGFVRDNAMIWSLISSTM 1423
gi 157871486 1345 ILSPkgSKSPSVISEL-PVRNGTKAASAIDIVRSLLNMISSNVTQLAYLHARLHGVPNIFFAGGFVRDNAMIWSLISTTM 1423
                        1450      1460      1470
                  ....*....|....*....|....*....|....*.
gi 146095976 1424 KYWSSGGCHAHFLEHDGYLGALGCAILDPQGDAAKE 1459
gi 71653816  1445 QYWSKGESHAHFLKHDGYLGVLGSATMPTDSETASK 1480
gi 71650128  1445 QYWSKGESHAHFLKHDGYLGVLGSATMPTDSETASK 1480
gi 71755785  1435 AYWSKGECHAHFLGHDSHLGALGAATNTEEHVS--- 1467
gi 146091517 1424 KYWSSGGCHAHFLEHDGYLGALGCAILDPQGDAAKE 1459
gi 154340187 1424 KYWSSGECHAHFLEHDGYLGALGCAILNSHRDATNE 1459
gi 157871486 1424 KYWSSGECHAHFLEHDGYLGALGCAILDPHGDAANE 1459
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap