Conserved Protein Domain Family
PTZ00299

?
PTZ00299: PTZ00299 
homoserine kinase; Provisional
Statistics
?
PSSM-Id: 140320
View PSSM: PTZ00299
Aligned: 6 rows
Threshold Bit Score: 593.405
Threshold Setting Gi: 72390531
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71399862    1 MSDPPKKVVLRVPATTANLGPAYDVLGMALSIFMEVTVEHADEFSVHLEGDGSEHISADRENLMVKACELAFTEFAKKEM 80
gi 71656330    1 MSDPPKKVVLRVPATTANLGPAYDVLGMALSIFMEVTVEHADEFSVHLEGDGSEHISADRENLMVKACELAFTEFAKKAM 80
gi 72390531    1 MCVLPRKVVVRVPATTANMGPAYDSIGMALSIFAELTVEHSDAFSMSVEGEGCEEIQRDEQNMVVRACCLAF-EYGNKKM 79
gi 146094094   6 ATPLPKKVSLRVPATTANIGPAYDTLGMALSIFMELTVELAETFSMTVTGEGQEYISTGEDNMVVQTCRIAFEEYAHKSM 85
gi 154341961   6 ATPLPRKVAVRVPATTANIGPAYDTFGMALSIFMELTVELAETFSMTVTGEGHEHISTGEDNMVVQTCRIAFEEYAHKSM 85
gi 157872776   6 AKPLPEKVSLRVPATTANIGPAYDTLGMALSIFMELTVELAEAFSMTVTGEGQEHISTGEDNMVVQTCRIAFEEYAHKSM 85
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71399862   81 PPLKFIMKSNIPFGCGCGSSSAAAVAGFVAGMKLCGLTMKTEEEEALLQVIARFEGHPDNAAPAIYGGIQLGYKDNNGRF 160
gi 71656330   81 PPLKFTMKSNIPFGCGCGSSSAAAVAGFVAGMKLCGLTMKTEEEEALLQVIARFEGHPDNAAPAIYGGIQLGYKDNNGRF 160
gi 72390531   80 PTLRFIMRSDIPYGCGCGSSSAAAVAGFVAGLQLCGHTMATGSEEELLQAIAKFEGHPDNAAPALYGGIQLCYKEHGGRV 159
gi 146094094  86 PPLKFTMHNNIPYKCGCGSSSAAAVAGFVAGMTLSGLTMETHNNESLLSAISKIEGHSDNAASAIYGGIQLVYKKDDDRA 165
gi 154341961  86 PPLKFIMHNNVPYRCGCGSSSAAAVAGFVAGMTLCGLTMETQNREALLLAISKIEGHSDNAAPAIYGGIQLVYKKDEESL 165
gi 157872776  86 PPLKFTMHNNIPYKCGCGSSSAAAVAGFVAGMMLSGLTLETHNSESLLSAISKIEGHSDNAAPAIYGGIQLVYKKDDGRT 165
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71399862  161 LTYRVPTPASLLVVLFVPKNKMKLNTHATRNLIPSSVSLEDTVFNISRSSILVLALCTGDLRLLKSCDDKLHQKQRADAL 240
gi 71656330  161 LTYRVPTPASLLVVLFVPKNKMKLNTHATRNLIPSSVSLEDTVFNISRSSILVLALCTGDLRLLKSCDDKLHQKQRADAL 240
gi 72390531  160 LTTRVPTPFALSVVLFIPREKMKENTHVTRGLIPDFVPLEDAVYNISCASILVLALSTGDLRTLRSCGDKIHEGQRGDAL 239
gi 146094094 166 MTYHVPTPPNLSIVLFVPHKLMKASTHVTRDLVPTTVSLRDAVRNISGTAILTLALSTGDLRMLTDASDCLHEQQRSRKL 245
gi 154341961 166 MTYHVPTPPNLAIVLFVPHRLMKASTHVTRDLVPTTVSLRDAVHNISSTAILTLALSTGDLRMLKDASDCLHEQQRSSKL 245
gi 157872776 166 MTYHVPTPPNLSIVLFVPHKLMKASTHVTRELVPTAVSLRDAVHNISGTAILTLALSTGDLRMLKDASDCLHEQQRSRKL 245
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71399862  241 FPHFRPCVDAAMAAGAHYAFLSGAGPSVCALVGGRHGDPLTQPRGERIAESVAEAMIQAANAVGVAGRAILTQPSDQGVH 320
gi 71656330  241 FPHFRPCVDAAMAAGAHYAFLSGAGPSVCALVGGRHGDPLTQPRGERIAESVAEAMIQAANAVGVAGRAILTQPSDQGVH 320
gi 72390531  240 FPHFRPCVNAAKEAGAAYAFLSGAGPTVCALVGGRHGEVLTQPKEERVAERVALAMIDAACAVGVEGRVVITQPSDQGVH 319
gi 146094094 246 YPHYSACAKAAREAGAVYAFLSGAGPSVCAMVPGRHGDLLTQPMEERKAEVVAEAMVKAAEAVGVQGRVIITMPSDFGVH 325
gi 154341961 246 YPHYNACAKAAREAGAVYSFLSGAGPSVCAMVPGRHGDFLSQPEGERKAEMVAEAMVKAAEAVGVHGRAIITIPSNLGAH 325
gi 157872776 246 YPHYSACAKAAREAGAEYAFLSGAGPSVCAMVSGRHGDLLTQPMEERKAEMVAEAMVKAAEAVGVQGRVIITMPSDVGVH 325
                        330
                 ....*....|....*.
gi 71399862  321 CVGVTTIRPDMEYISI 336
gi 71656330  321 CVGVTTIRPDMEYISI 336
gi 72390531  320 VVGAKPVRHNLVYVST 335
gi 146094094 326 LSGTTCIRPNIQYTSI 341
gi 154341961 326 LPGTTCIRPNIQYTSI 341
gi 157872776 326 LSGTTCIRPNIQYTSI 341
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap