Conserved Protein Domain Family
PTZ00300

?
PTZ00300: PTZ00300 
pyruvate kinase; Provisional
Statistics
?
PSSM-Id: 140321
View PSSM: PTZ00300
Aligned: 9 rows
Threshold Bit Score: 905.192
Threshold Setting Gi: 154344359
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71419545   46 MSVARMNFSHGSHEYHQTTINNLRAAATELGAHIGLALDTKGPEIRTGLFKDGGIALAPGDTVLVTSDPAFEKIGTKEKF 125
gi 71667353   46 MSVARMNFSHGSHEYHQTTINNLRAAATEIGAHIGLALDTKGPEIRTGLFKDGGIALAPGDTVLVTSDPAFEKIGTKEKF 125
gi 72546713    1 MSVARMNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGEAVMERGATCYVTTDPAFADKGTKDKF 80
gi 72546717   46 MSVARMNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGEAVMERGATCYVTTDPAFADKGTKDKF 125
gi 146100263  54 MSVARMNFSHGSHEYHRTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGEAVMERGATCYVTTDPAFADKGTKDKF 133
gi 146100276   1 MSVARMNFSHGSHEYHRTTINNVRQAAAELGVNIAIALDTKGPEIRTGQFVGGEAVMERGATCYVTTDPAFADKGTKDKF 80
gi 154344357   1 MSVVRMDFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGLFVGGVAVMEKDATCYVTTDPAFSDKGTKDKF 80
gi 154344359   1 MSVARKNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGLFVGGVAVMEKDATCCVTTDPAFSGKGTKDKF 80
gi 154344353   1 MSVARMNFSHGSHEYHQTTINNVRQAAAELGVNIAIALDTKGPEIRTGLFVGGVAVMEKDATCYVTTDPAFSDKGTKDKF 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71419545  126 YIEYPRLSITVRPGGFIYIDDGVLSLKVLSKEDEYTLKCYVNNAHFLTDRKGCNLPGCEVDLPAVSEKDREDLKFGVEQG 205
gi 71667353  126 YIEYPRLSITVRPGGFIYIDDGVLSLKVLSKEDDYTLKCYVNNAHFLTDRKGCNLPGCEVDLPAVSEKDREDLKFGVEQG 205
gi 72546713   81 YIDYQNLSKVVRPGSYIYIDDGILILHVQSHEDEQTLKCTVTNAHTISDRCGVNLPGCDVDLPAVSAKDCADLQFGVEQG 160
gi 72546717  126 YIDYQNLSKVVRPGSYIYIDDGILILHVQSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSAKDCADLQFGVEQG 205
gi 146100263 134 YIDYQNLSKVVRPGSYIYIDDGILILHVQSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSAKDCADLQFGVEQG 213
gi 146100276  81 YIDYQNLSKVVRPGSYIYIDDGILILHVQSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSAKDCADLQFGVEQG 160
gi 154344357  81 YIDYANLPKVVSPGGYIYIDDGILILQVQSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSPKDCADLQFGVEQG 160
gi 154344359  81 YIDYANLPKVVSPGGYIYIDDGILILQVQSHEDEQTLKCTVTNAYTISDRRGVNLPGCDVDLPAVSPKDCADLQFGVEQG 160
gi 154344353  81 YIDYANLPKVVSPGGYIYIDDGILILQVQSHEDEQTLKCTVTNAHTISDRRGVNLPGCDVDLPAVSPKDCADLQFGVEQG 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71419545  206 IDMVFASFIRTAEQVQEVREALGEKGKDILIISKIENHQGVQNIDGIIEASDGIMVARGDLGVEIPAEKVVVAQMILISK 285
gi 71667353  206 IDMVFASFIRTAEQVQEVREALGEKGKDILIISKIENHQGVQNIDAIIEASDGIMVARGDLGVEIPAEKVVVAQMILISK 285
gi 72546713  161 VDMIFASFIRSAEQVGDVRKALGAKGHDIMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISK 240
gi 72546717  206 VDMIFASFIRSAEQVGDVRKALGAKGHDIMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISK 285
gi 146100263 214 VDMIFASFIRSAEQVGEVREALGAKGRDIMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISK 293
gi 146100276 161 VDMIFASFIRSAEQVGEVREALGAKGRDIMIICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISK 240
gi 154344357 161 VDIIFASFIRSAEQVVEVRKALGAKGGDIMVICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISK 240
gi 154344359 161 VDIIFASFIRSAEQVVEVRKALGAKGGDIMVICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISK 240
gi 154344353 161 VDIIFASFIRSAEQVVEVRKALGAKGGDIMVICKIENHQGVQNIDSIIEESDGIMVARGDLGVEIPAEKVVVAQKILISK 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71419545  286 CNVAGKPVICATQMLESMTTNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSATNQAVMFN 365
gi 71667353  286 CNVAGKPVICATQMLESMTTNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSATNQAVMFN 365
gi 72546713  241 CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSAVNEYVFFN 320
gi 72546717  286 CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSAVNEYVFFN 365
gi 146100263 294 CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSAVNEYVFFN 373
gi 146100276 241 CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNEVVQYMARICLEAQSAVNEYVFFN 320
gi 154344357 241 CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNGVVQYMARICLEAQSAINEYVFFN 320
gi 154344359 241 CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNGVVQYMARICLEAQSAINEYVFFN 320
gi 154344353 241 CNVAGKPVICATQMLESMTYNPRPTRAEVSDVANAVFNGADCVMLSGETAKGKYPNGVVQYMARICLEAQSAINEYVFFN 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71419545  366 SIKKMQKLPMSPEEAVCSSAVNSVYEVRAKALLVLSNSGRSARLASKYRPDCPIICATTRMRTCRQLTITRSVDAVFYDA 445
gi 71667353  366 SIKKMQKLPMSPEEAVCSSAVNSVYEVRAKALLVLSNSGRSARLASKYRPDCPIICATTRMRTCRQLTITRSVDVVFYDA 445
gi 72546713  321 SIKKLQPIPMSAEEAVCSSAVNSVYETKAKVMVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDA 400
gi 72546717  366 SIKKLQPIPMSAEEAVCSSAVNSVYETKAKVMVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDA 445
gi 146100263 374 SIKKLQPIPMSAEEAVCSSAVNSVYETKAKVMVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDA 453
gi 146100276 321 SIKKLQPIPMSAEEAVCSSAVNSVYETKAKVMVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDA 400
gi 154344357 321 SIKKLQPIPMSVEEAVCSSAVNSVYETKAKALVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDA 400
gi 154344359 321 SIKKLQPIPMSVEEAVCSSAVNSVYETKAKALAVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDA 400
gi 154344353 321 SIKKLQPIPMSVEEAVCSSAVNSVYETKAKALVVLSNTGRSARLVAKYRPNCPIVCVTTRLQTCRQLNITQGVESVFFDA 400
                        410       420       430       440       450
                 ....*....|....*....|....*....|....*....|....*....|....
gi 71419545  446 ERYGEDENKEKRVQLGVDCAKKKGYVVPGDLMVVVHADHKVKGYPNQTRIIYVS 499
gi 71667353  446 ERYGEDENKEKRVQLGVDCARKKGYVVPGDLMVVVHADHKVKGYPNQTRIVYVS 499
gi 72546713  401 EKLGHDEGKEQRVAMGVGFAKSKGYEQSGAVVFMIDIFQSKGIDVMRSTIIVGK 454
gi 72546717  446 EKLGHDEGKEQRVAMGVGFAKSKGYVQTGDYSVVIHADHKVKGYANQTRILLVE 499
gi 146100263 454 EKLGHDEGKEQRVAMGVGFATSKGYVQTGDYCVVIHADHKVKGYANQTRILLVE 507
gi 146100276 401 EKLGHDEGKEQRVAMGVGFATSKGYKLSGALVAIVDILRWWGCRVGQSTIIERK 454
gi 154344357 401 DRLGHDEGKEDRVATGVEFAKSRG------------------------------ 424
gi 154344359 401 DRLGHDEGKEDRVATGVEFAKSRD------------------------------ 424
gi 154344353 401 DRLGHDEGKEDRVATGVEFAKSRGFVQSGDSCVVVHADHKVKGYANQTRILLVS 454
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap