Conserved Protein Domain Family
PTZ00303

?
PTZ00303: PTZ00303 
phosphatidylinositol kinase; Provisional
Statistics
?
PSSM-Id: 140324
View PSSM: PTZ00303
Aligned: 3 rows
Threshold Bit Score: 2360.13
Threshold Setting Gi: 157872487
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838    1 MSDAAAATAAAEAATTARTENPVAVCPATPPPTNCIGSVWLGVYDRVSHTRFRIHIEDPVFLCILSNAVVPAAESDGSLP 80
gi 154335222    1 MADLLAATAAADVTTPGRTENPVTVSPPTPPPTSCIGSVWLGVYDRVSHTRFRIHVEDPIFICILSNTVVPVAESDGSLP 80
gi 157872487    1 MSDAPAATAAAEAATTARTENPVAVCPATPPPTNCIGSVWLGVYDRVSHTRFRIHIEDPVFLCIVSNTVVPAAESDGSLP 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838   81 FEIQEFVEYLDAYERERLRQAYAARRGPN--------------TSGGAVGSGRCGVHGDPAAAAATAGSCGAGGAVSGSG 146
gi 154335222   81 FEMLEFVEYLDAYERERLRQAYAARRGANsgsftainsgvnavSSSGTAGSGRSGAHGDTAVAATAAGSCGAGGVGLGSS 160
gi 157872487   81 FEMQEFVECLDAYERERLRQAYAARRGTN--------------TSGGGVGIGRCGVHGDPAAAAATAGSCGAGGAVSGSG 146
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838  147 AIYSGVSGIPSMCCLNScspaGGPVPRKLEEALRETLSENSDFFFRVSSVAYHLDPNPQGASACTSASASAGSGVMGNAG 226
gi 154335222  161 AVHSGVSGIPSSGGLNS----GAPVPRKLEETLRETLSENSDFFFRVSSVAYHLDPNTQGASACTAASAGAASGVIGNVG 236
gi 157872487  147 AIHSGVFGIPPMCCLNScspaGGPVPRKLEETLRETLSENSDFFFRVSSVAYHLDPNPQGASACTPASASVGSGVMGNAG 226
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838  227 VGARSPRRGEGLASAAAGGVASLLTNTIAAASATGPPPRRNYSVHSGYSAAFHLCGRLFADVYRDHCRALAQKIASGFSG 306
gi 154335222  237 VGTRVPSRGEGRASAAAGGVASLFTNTIAAASATGPPPRRNYSVHSGYSAAFHLCGRLFADVYTDHCRTLAQKIACGFSA 316
gi 157872487  227 VGACSPRRGEGLASAAAGGVASLLSNTIAAASATGPPPRRKYSVHSGYSAAFHLCGRLFADVYRDHCRALAQKIASGFSG 306
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838  307 LRVEDCVKFRKAVWSGFHLKALEPYRSGARSESNLELRWVSEKIKDDQHLFPSRGVAPQQQSSHVSRLVDATLSYVANAR 386
gi 154335222  317 LHVEDCVKFRKAVWSGFHLKALEPYRSGARSESNLELRWVSEKIRDDQHLFPSRSVAPQQQSSDASRLVDATLSYVANAR 396
gi 157872487  307 LRVEDCVKFRKAVWSGFHLKALEPYRSGARSESNLELRWVSEKIKDDQHLFPSRGVAPQQESSHVSRLVDATLSYVANAR 386
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838  387 LRGRPSSSVGGNANSSTGGNGAAGAGGAGAAGKGGGSAAARATVGGVAEENELNTFGLTKLLHNPSWQKDDESSDSCPSC 466
gi 154335222  397 LRVRPGSGIGGIASGSTGSSGTAGASGGGAAGKGSGGAAARAAVGSDAEENELNTFGLTKMLHNPSWQKDDESSDSCPSC 476
gi 157872487  387 LRGRPSSSIGGNANSSTGGNGAAGAGGAGAAGKGGGSAAARATVGGVAEENELNTFGLTKLLHNPSWQKDDESSDSCPSC 466
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838  467 GRAFISLSRPLGTRAHHCRSCGIRLCVFCITKRAHYSFAKLAKPGSSDEAEERLVCDTCYKEYETVSQLHYLGALFAFAG 546
gi 154335222  477 GRVFVSLSRPLGTRAHHCRSCGVRLCVFCITKRAHYSFAKLAKPGSSDEAEERLVCDTCYREYETVSQLHYLGALFAFAG 556
gi 157872487  467 GRAFISLSRPLGTRAHHCRSCGIRLCVFCITRRAHYSFAKLAKPGSSDEAEERLVCDTCYKEYETVSQLHYLGALFAFAG 546
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838  547 LGFSDLVLCRTVNEQWREAAELCISEYRLLLHNCDADLHSVKTPVGILLQNSLFLLLGDGPTSSIPVVHHPEAALLLLKF 626
gi 154335222  557 LGFSDLVLCRTVNEQWREAAELCISEYRLLLHNCDADLHSVKTPVGILLQNSLFLLLGDGPTSSIPVVHHPEAALLLLKF 636
gi 157872487  547 LGFSDLVLCRTVNEQWREAAELCISEYRLLLHNCDANLHSVKTPVGILLQNSLFLLLGDGPTSSIPVVHHPEAALLLLKF 626
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838  627 IATENLWVPDASYYFIWRLSSSVLNRADTVLTSLPSLSSSAASAVESKHHSFQLPVVPNFSHWHLFCTAFCSKIGSSYFF 706
gi 154335222  637 IATENLWVPDASYYFIWRLSSSVLNRADTVLTTLPSLSSSVAPVVESKHRSFQLPVVPNFSHWHLFCTAFCSKIGASYFF 716
gi 157872487  627 IATENLWVPDASYYFIWRLSSSVLNRADTVLTSLPSLSSSAASAVESKHHSFQLPVVPNFSHWHLFCTAFCSKIGSSYFF 706
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838  707 VKCAELLCAAPTKVYDAYVASALERMTRVYLSTTALWKRLAEANQATAASFAAWTSSPPTTAPLPLPMLSDVTEGQVVTV 786
gi 154335222  717 VKCAELLCAAPAKVYDAYVASALERMTRVYLSTTPLWKRLAEANQATVAVFTARTSSPPTTTPLPLPTLSDVTEGQVVTV 796
gi 157872487  707 VKCAELLCAAPAKVYDAYVASALERMTRVYLSTTPLWKRLAEANQATAAAFAARTSSPPTTAPLPLPMLSDVTEGQVVTV 786
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838  787 WLLDMLHKDALVPAQRRRFQQLLEQVIPTVAGSSLSLVFIMLLSLQSTYSYYGYDEDLFGLWRTRIVAEVGRKDPVARDR 866
gi 154335222  797 WLLDMLHKDALVPTQRRRFQQVLERVIPVVANSSLSLVFIMLLSLQSTYSYYGYDEDLFGLWRTRIVAEVGRKDPAARDR 876
gi 157872487  787 WLLDMLHKDALVPAQRRRFQQLLEHVIPTVAGSSLSLVFIMLLSLQSTYSYYGYDEDLFGLWRTRIVAEVGRKDPVARDR 866
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838  867 VVATLDFFHELDRFCAQSSVVSQTSVVGWIVAYCRRCTPKAPASATGAPGEATTPSARRGYHHSYIDLPHPILNPFKPYI 946
gi 154335222  877 VLATLDFFNELDRFCAQSSVVNQTSVVGWIVAYCRRGAPKVSASATGAKEEAVAPSARRIYQQSHIDLPHPILNPFKPYI 956
gi 157872487  867 VVATLDFFHELDGFCAQSSVVSQTSVVGWIVAYCRRGAPKAPASATGAPGEATMPSARRVYHHSYIDLPHPILNPFKPYI 946
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838  947 VLKSIRLSGVKVAPNAASKPTWLAFSTWSAAEHLERDTKTAAKNFGGHTLPTGESHAERSGEGREKGT-GAAPTYPSTKT 1025
gi 154335222  957 MLKSIRLSGIKVAPNAASKPTWLAFSTWSAAEHLAHDAMNPVNNFGARTALTGVSHAEKSVEGRAKGTeGGPKPCTAHIT 1036
gi 157872487  947 VLKSIRLSGVKVAPNAASKPTWLAFSTWSAAEHLERDTTTAAENFGRHTLPTGESHAERSGEGREKGT-GAASTYLSTKT 1025
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838 1026 SAPVTSPVAAVNGVSPELLHDSLPQECMFLYKRENVERDQLMCISSRLLQMLLSSEIGNAEMLDYSVLPLSCDSGLIEKA 1105
gi 154335222 1037 SATVTSSVTTVRGVSPASRYDSLPQECMFLYKRENVERDQLMCISSRLLQMLLSSEIGNAEMLDYSVLPLSCDSGLIEKA 1116
gi 157872487 1026 SAPVTRPVTAVNGVSPEALHESLPQEYMFLYKRENVERDQLMCISSRLLQMLLSSEIGNAEMLDYSVLPLSCDSGLIEKA 1105
                        1130      1140      1150      1160      1170      1180      1190      1200
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838 1106 EGRELSNLDNMDIASYVLQRGTRSCINFLASAKLFLLLNYIFSIGDRHKGNVLIGTNGALLHIDFRFIFSEKTFVEKLAR 1185
gi 154335222 1117 EGRELSNLDNMDITSYVLYRGTQGCINFLASAKLFLLLNYIFSIGDRHKGNVLIGTNGALLHIDFRFIFSEKTFVEKLAR 1196
gi 157872487 1106 EGRELSNLDNMDIASYVLHRGTRSCINFLASAKLFLLLNYIFSIGDRHKGNVLIGTNGALLHIDFRFIFSEKTFVEKLAR 1185
                        1210      1220      1230      1240      1250      1260      1270      1280
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838 1186 STVRIDDAFLAAVEQCQQRQCPCFAGPSPAAASSYARGCTSPPGSPGSGGCGSSASPTKAPEPSSAEIREAFFSSAAEWF 1265
gi 154335222 1197 STVRIDDAFLAAVEQCQQRQGSAKCEPSTVATSSRPRGCASLPGASGGGGCVLPANPVRAPEPSSAEIRAAFFSSAAEWF 1276
gi 157872487 1186 STVRIDDAFLAAVEQCQQRQCSCFAGSSPAATSSHAQGWASPPASSGSGGRGSCASPTKAPEPSSAEIREAFFSSAAEWF 1265
                        1290      1300      1310      1320      1330      1340      1350      1360
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146093838 1266 VHVRPFAAVFYELWLYAVHRHTVPYNDAEMLNMLNTLFDRHASQTSSASKFSTTMKESVNVCRLKDVTHSSAEVLRTFAD 1345
gi 154335222 1277 VHVRPFAAVFYELWLYAVHRHTVPYNDGEMLNMLNTLFDRHASQTSSACKFSTTMTESVNVCRLKDVTHSSAEVLRTFAD 1356
gi 157872487 1266 VHVRPFAAVFYELWLYAVHRHTVPYNDAEMLNMLNTLFDRHASQTSSASKFSTTMKESVNVCRLKDVTHSSAEVLRTFAD 1345
                        1370      1380
                  ....*....|....*....|....*....
gi 146093838 1346 QVSRRVSESSVDAMKMMGSMWSSWWSRGG 1374
gi 154335222 1357 QVSRRVSESSVDAVKMMGSMWSSWWSRGR 1385
gi 157872487 1346 QVSRRVSESSVDAMKMMGSMWSSWWSRGG 1374
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap