Conserved Protein Domain Family
PTZ00306

?
PTZ00306: PTZ00306 
NADH-dependent fumarate reductase; Provisional
Statistics
?
PSSM-Id: 140327
View PSSM: PTZ00306
Aligned: 10 rows
Threshold Bit Score: 2202.66
Threshold Setting Gi: 72388944
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                          10        20        30        40        50        60        70        80
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72547207     1 MGGCATATQRRCAATDSHTGASVVVVDPEKAARERDRIARDLLTTNFPELHVNQRWVLLYKDVMHTVPYTLTIAVDGSVA 80
gi 71410008    47 SPALLSQRSFFSGGADGRSSASIVVVDAELAAKERDRIAREMLSQNMPSPHAEERLVVTMRGLEHTVPYTLRIVLNGPNE 126
gi 71400421     1 -------------MADGRSSASVVAVDPEKAARERDEAARALLRDS----PLQTHLQYMTNGLELTVPFTLKV-VAEAVA 62
gi 71747118    56 PSVVSCQKRFTSHGADGISSASIVVTDPEAAAKKRDRMARELLSSNSGLCQEDEPTIINLKGLEHTIPYRLAVVLCNSRS 135
gi 72388944     1 -------------MVDGRSSASIVAVDPERAARERDAAARALLQDS----PLHTTMQYATSGLELTVPYALKV-VASADT 62
gi 72547417     1 -------------MADGKTSASVVAVDAESAAKERDAAARAMLQDG--GVSPVGKAQLLKKGLVHTVPYTLKVVVADPKE 65
gi 146100731    1 -------------MADGKTSASVVAVDAESAAKERDAAARAMLQDG--GVSPVGKAQLLKKGLVHTVPYTLKVVVADPKE 65
gi 146100590    1 MGGCATSLCRRCAATDSHTGASVVVSDPEKAARERDRIARGLLTTNFPELHVNQRSVLRYKDVMHTVPYTLTIAVDGNVA 80
gi 154344555    1 -------------MADGKTSASVVAVDPERAAKERDAAARAMLQDG--GVSPVGKAQLLKKGLAYAVPYTLKIVVADPKA 65
gi 154344505    1 MGASAMATQRRCTVSDSHTGASIVVVNPEKAARERDRIARDLLTTNFPELHVNQRSVLLYKDVVHTVPYTLSIAVDGSVT 80
                          90       100       110       120       130       140       150       160
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72547207    81 RQDADPVVKAILSDCFAMVDKHLNSFNPDSEVSQVNRMPVGKKHVMSEHLFEVVKCCEEVYHRSGSCFDPAAAPLVHKLR 160
gi 71410008   127 AKNGEVIAGKVLKEAFEVVDQHLNHYNPESEVSAINQLPLGAKHTMSQHMRRVMECCVRVYASSGACFDPATGPLVEFLR 206
gi 71400421    63 FSRAKEVADEVLRSAWHLADTVLNNFNPNSEISMIGRLPVGQKHTMSATLKSVITCCQHVFNSSRGVFDPATGPIIEALR 142
gi 71747118   136 TGEFEAKAAEILRKAFHMVDYSLNCFNPESELSRVNSLPVGEKHQMSEDLRHVMECTISVHHSSGMGFDPAAGPIISRLR 215
gi 72388944    63 FDRAKEVADEVLRCAWQLADTVLNSFNPNSEVSLVGRLPVGQKHQMSAPLKRVMACCQRVYNSSAGCFDPSTAPVAKALR 142
gi 72547417    66 MEKATADAEEVLQSAFQVVDTLLNSFNENSEVSRINRMPVGEEHQMSAALKHVMACCQKVYNSSRGAFDPAVGPLVRELR 145
gi 146100731   66 MEKAAADAEQVLQAAFQVVDTLLNNFNENSEVSRINRMPVGEEHQMSAALKHVMACCQKVYNSSRGAFDPAVGPLVRELR 145
gi 146100590   81 RQDVDPVVKAILSDCFAMVDKHLNSFNPGSEVSQVNRMPVGKKHVMSEHLFEVVKCCEEVYSSSGSCFDPAAAPLVHKLR 160
gi 154344555   66 MEKTTADVEKVLQTAFQVVDTLLNNFNENSEVSRINRMPVGEEHQMSAALKRVMGCCQRVYNSSRGAFDPAVGPLVRELR 145
gi 154344505   81 RQDADPVVKAILSNCFTMVDTHLNSFNPDSEVSKVNRMPVGEKHVMSEHLCKVVKCCEEIYNISGSCFDPAAAPLVHRLR 160
                         170       180       190       200       210       220       230       240
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72547207   161 DAARRQDSTEGDFAItAEEAGRFTLTNSFAIDIKEGTIARKHEDATLDLGGLNKGYTVDCVVDQLNAANFADVLFEWGGD 240
gi 71410008   207 SVMKDEKSDAESTLT-EEEVERFCLPQSFDVNMTDGTIARKHEGAKLDLGGVNKGYTVDRVVEKLNAAGMRDVMFEWGGD 285
gi 71400421   143 AKVAEKASVSDEQM--EKLFRVCNFSSSFIVDLEMGTIARKHEDARFDLGGVSKGYIVDYVVERLNAAGIVDVYFEWGGD 220
gi 71747118   216 GAMRDHNDMSDISVT-EAEVELFSLAQSFDVDLEEGTIARKHSEARLDLGGVNKGYTVDYVVDHLRAAGMPNVLFEWGGD 294
gi 72388944   143 EIALGKERNNACL---EALTQACTLPNSFVIDFEAGTISRKHEHASLDLGGVSKGYIVDYVIDNINAAGFQNVFFDWGGD 219
gi 72547417   146 EAAHKGKTVPAERV--NDLLSKCTLNASFSIDMNRGMIARKHADAMLDLGGVNKGYGIDYTVERLNSLGYDDVFFEWGGD 223
gi 146100731  146 EAAHKGKTVPAEHV--NDLLSKCTLNASFSIDMNRGMIARKHADAMLDLGGVNKGYGIDYIVERLNSLGYNDVFFEWGGD 223
gi 146100590  161 DAARRQDSAEGDFAIsAEEAGRFTLTNSFAIDIKEGTIARKHEDAMLDLGGLNKGYTVDCVVDRLNAANFADVLFEWGGD 240
gi 154344555  146 EAAREGRTLPAERI--NALLSKCTLNISFSIDLNRGTIARKHADAMLDLGGVNKGYGVDYVVEHLNNLGYDDVFFEWGGD 223
gi 154344505  161 NAARRQDSTEADFMItAEVAGRFTLTNSFAINVKEGTIARKHEDAMLDLGGLNKGYTVDCVVDQLNAANFSDVLFEWGGD 240
                         250       260       270       280       290       300       310       320
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72547207   241 CRASGVNVQRQPWAVGVVRPPSVDEIVAAAKSGKSmtmnahslgdhtdepapstlaadgaAKPAHKAFLRVMSLSNEALC 320
gi 71410008   286 CRATGVNYQHQPWAIAIVRPPPVEVVEQHAKEGLD-------------------------EKKEASQLLRLMYLDDEALC 340
gi 71400421   221 CRASGTNARRTPWMVGIIRPPSLEQLR---------------------------------NPPKDPSYIRVLPLNDEALC 267
gi 71747118   295 IRASGRNIKGNLWAVAIKRPPSVEEVIRRAKGKMLkmgee----------------eqeeKDDDSPSLLHVVELDDEALC 358
gi 72388944   220 CRASGMNARNTPWVVGITRPPSLDMLR---------------------------------NPPKEASYISVISLDNEALA 266
gi 72547417   224 VRASGKNQSIQPWAVGIVRPPALADIRTV-------------------------------VPKDKRSFIRVVHLNNEAIA 272
gi 146100731  224 VRASGKNQSNQPWAVGIVRPPALADIRTV-------------------------------VPEDKRSFIRVVRLNNEAIA 272
gi 146100590  241 CRASGVNVQRQPWAVGVVRPPSVDEVVAAAKSGKSvtmnahslgdhtdepaqstsaadgaAKAEHKALLRVMSLSNEALC 320
gi 154344555  224 VRASGKNPSNQHWVVGIARPPALADIRTV-------------------------------VPQDKQSFIRVVCLNDEAIA 272
gi 154344505  241 CRASGVNVQRQPWAVGVVRPPSVDEVVAASKSGKSvtmnahslgersdepaqsasaadgaAKPGHKTLLRVMSLSNEALC 320
                         330       340       350       360       370       380       390       400
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72547207   321 TSGDYENVLFANAlGCALSSTYNWRRRCLIEPCQNELAQVSIKCYSCLYADALATASFVKRDPVRVRYMLEPYRHDYNRV 400
gi 71410008   341 TSGDYENVMYSPK-YGVRSNIFDWKKRSLLEPVESELAQVSIKCYSAMYADALATASLIKRDISKVRHMLEEWRHSRNRV 419
gi 71400421   268 TSGDYENLTEGSN-KKLYTSIFDWKKRSLLEPVESELAQVSIRCYSAMYADALATASLIKRDIKKVRQMLEDWRHVRNRV 346
gi 71747118   359 TSGDYENVLYHPK-HGVAGSIFDWQRRGLLSPEEGALAQVSVKCYSAMYADALATVCLVKRDAVRIRYLLEGWRYVRSRV 437
gi 72388944   267 TSGDYENLIYTAD-DKPLTCTYDWKAKELMKPSQSNIAQVSVKCYSAMYADALATACFIKRDPAKVRQLLDGWRYVRDTV 345
gi 72547417   273 TSGDYENLIETPA-SKVYSSTFDRASKNLLEPTEAGMAQVSVKCYSCMYADALATAALLKNDPAAVRRMLDNWRYVRDTV 351
gi 146100731  273 TSGDYENLIEGPG-SKVYSSTFDPASKNLLEPTEADMAQVSVKCYSCMYADALATAALLKNDPAAVRRMLDNWRYVRDTV 351
gi 146100590  321 TSGDYENVLFANAlGCALSSTYDWRRRCLIEPCRNELAQVSIKCYSCLYADALATASFVKRDPVRVRYMLEHYRHDYNRV 400
gi 154344555  273 TSGDYENLVEGPG-SKVYSSTFNATSKSLLEPTETNIAQVSVKCYSCMYADALATAALLKNNPTAVRRMLDNWRYVRDTV 351
gi 154344505  321 TSGDYENVLFVNAlNRAVSSTYDWRHRCLIGPSQGGLAQVSVKCYSCLYADALATASFVKRNPVPIRYMLEHYRRDYNRV 400
                         410       420       430       440       450       460       470       480
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72547207   401 TDYAAYTREGERLAHMYEIAHESPACRIERIAGSLPARVVVIGGGLAGCAAAIEAASCGATVILLEKEARLGGNSAKATS 480
gi 71410008   420 TNYVTYTRQGERVARMFEIATENAEIRKNRIAGSLPARVIVVGCGLAGLSAAIEATACGAQVILLEKEPKVGGNSAKATS 499
gi 71400421   347 TNYVTYTRQGERVARMFEIATDNAEIRKKRIAGSLPARVIVVGGGLAGLSAAIEATACGAQVILLEKEPKVGGNSAKATS 426
gi 71747118   438 TNYFAYTRQGERLAHMHEIAQETRELREIRIAGSLPSRIVIVGGGLAGLSAAIEAASCGAQVILMEKEGRIGGNSAKATS 517
gi 72388944   346 RDYRVYVRENERVAKMFEIATEDAEMRKRRISNTLPARVIVVGGGLAGLSAAIEAAGCGAQVVLMEKEAKLGGNSAKATS 425
gi 72547417   352 TDYTTYTREGERVAKMLEIATEDAEMRAKRIKGSLPARVIIVGGGLAGCSAAIEAANCGAQVILLEKEPKLGGNSAKATS 431
gi 146100731  352 TDYTTYTREGERVAKMLEIATEDAEMRAKRIKGSLPARVIIVGGGLAGCSAAIEAANCGAQVILLEKEPKLGGNSAKATS 431
gi 146100590  401 TDYAAYTREGERLAHMYEIAHESPACRIERIAGSLPARVVVIGGGLAGCAAAIEAASCGATVILLEKEARLGGNSAKATS 480
gi 154344555  352 TDYTTYSREGERVAKMFEIATEDKEMRAKRISGSLPARVIIVGGGLAGCSAAIEAVNCGAQVILLEKEAKIGGNSAKATS 431
gi 154344505  401 TDYTAYTREGERLAHMYEIACESPACRTERIAGSLPARVVVIGGGLAGCAAAIEAASCGATVILLEKEARLGGNSAKATS 480
                         490       500       510       520       530       540       550       560
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72547207   481 GINGWGTRTQAVNHVLDNCKFFERDTFLSGKGGHCDPGLVRTLSVKSAEAISWLESFGIPLTVLYQLGGASRRRCHRAPD 560
gi 71410008   500 GINGWGTRAQALDDIQDNCNIFERDTHKSGLGGSTVPSLVRTLSVKSGDAISWLSSLGVPLTVLSQLGGHSRKRTHRAPD 579
gi 71400421   427 GINGWGTRAQAEQDVYDSGKYFERDTHKSGLGGSTDPGLVRTLSVKSGDAISWLSSLGVPLTVLSQLGGHSRKRTHRAPD 506
gi 71747118   518 GINGWGTRTQAKSDILDGGKYFERDTFLSGVGGTTDPALVKVLSVKSGDAIGWLTSLGVPLSVLSQLGGHSFKRTHRAPD 597
gi 72388944   426 GINGWGTRAQAKASIVDGGKYFERDTYKSGIGGNTDPALVKTLSMKSADAIGWLTSLGVPLTVLSQLGGHSRKRTHRAPD 505
gi 72547417   432 GINAWGTRAQAKQGIMDGGKFFERDTHRSGKGGNCDPCLVKTLSVKSSDAVKWLSELGVPLTVLSQLGGASRKRCHRAPD 511
gi 146100731  432 GINAWGTRAQAKQGVMDGGKFFERDTHRSGKGGNCDPCLVKTLSVKSSDAVKWLSELGVPLTVLSQLGGASRKRCHRAPD 511
gi 146100590  481 GINGWGTRTQAVNHVLDNCKFFERDTFLSGKGGHCDPGLVRTLSVKSAEAISWLESFGIPLTVLYQLGGASRRRCHRAPD 560
gi 154344555  432 GINAWGTRAQAKQGVMDGGKFFERDTHRSGKGGHCDPCLVKTLSVKSSDAVKWLSELGVPLTVLSQLGGASRKRCHRAPD 511
gi 154344505  481 GINAWGTRTQAVNHVLDNCKFFERDTFLSGKGGHCDPGLVRTLSVKSAEAISWLESFGIPLTALYQLGGASRPRCHRAPD 560
                         570       580       590       600       610       620       630       640
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72547207   561 QKDGTPVPVGFTIMRHLEDHIRTKLQGKVTILNEMAVVSLMHDVSAMPDGNREIRVHGVRYTSMTDASGTVMDLPADAVV 640
gi 71410008   580 KADGTPVPIGFTIMRTLEQHVRTKLADRVTIMESTVVTSLLNEIKGTPDGGREVRVTGVTYKKSDEKEAGSMKLTADAVI 659
gi 71400421   507 KADGTPVPIGFTIMQTLEQHVRTKLADRVTIMENTTVTSLLSKSRVRHDGAKQVRVYGVEVLQD---EGVVSRILADAVI 583
gi 71747118   598 KTDGTPLPIGHTIMRTLEDHIRNNLSERVTIMTHVSVTELLHETDTTPDGASEVRVTGVRYRDLSDVDGQPSKLLADAVV 677
gi 72388944   506 KKDGTPLPIGFTIMKTLEDHVRGNLSGRITIMENCSVTSLLSETKERPDGTKQIRVTGVEFTQA---GSGKTTILADAVI 582
gi 72547417   512 KSDGTPVPVGFTIMKTLENHIVNNLSRHVTVMTGITVTALESTSHVRPDGVLVKHVTGVRLIQA---SGQSMVLNADAVI 588
gi 146100731  512 KSDGTPVPVGFTIMKTLENHIVNNLSRHVTVMTGITVTALESTSRVRPDGVLVKHVTGVRLIQS---SGQSMVLNADAVV 588
gi 146100590  561 QKDGTPVPVGFTIMRHLEDYIRTKLQGKVTILNEMAVVSLMHDVSAMPDGNREIRVHGVRYKSMTDASGTVMDLPADAVV 640
gi 154344555  512 KSDGTPVPIGFTIMKTLENHIINDLSHQVTVMTGIKVTGLESTSHARPDGVLVKHVTGVRLIQG---DGQSRVLNADAVI 588
gi 154344505  561 QKDGSPVPIGFTIMRHLENYIHTKLQGKVTILCETAVVSLLHDVSAMPDGSREIRVRGVRYKSTSDASEAVIDLPADAVV 640
                         650       660       670       680       690       700       710       720
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72547207   641 LATGGFSNDRTPNSLLREYAPNVYGTPTTNGTFATGDGVKMARKLGATLVDMDKVQLHPTGLIDPKDPSNRTKYLGPEAL 720
gi 71410008   660 LATGGFSNDHMSQSLIGEFAPELSGFPTTNGPWATGDGVKLARRLGATLVDMEKVQLHPTGLIDPKDPANPTKYLGPEAL 739
gi 71400421   584 LATGGFSNDKTPNSLLQEFAPQLSGFPTTNGPWATGDGVKLARELGVKLVDMDKVQLHPTGLIDPKDPANPTKYLGPEAL 663
gi 71747118   678 LATGGFSNDREENSLLCKYAPHLASFPTTNGPWATGDGVKLATSVGAKLVDMDKVQLHPTGLIDPKDPANTTKILGPEAL 757
gi 72388944   583 LATGGFSNDKTADSLLREHAPHLVNFPTTNGPWATGDGVKLAQRLGAQLVDMDKVQLHPTGLINPKDPANPTKFLGPEAL 662
gi 72547417   589 LATGGFSNDHTPNSLLQQYAPQLSSFPTTNGVWATGDGVKMASKLGVALVDMDKVQLHPTGLIDPKDPSNRTKYLGPEAL 668
gi 146100731  589 LATGGFSNDHTPNSLLQQYAPQLSSFPTTNGVWATGDGVKMASKLGVTLVDMDKVQLHPTGLLDPKDPSNRTKYLGPEAL 668
gi 146100590  641 LATGGFSNDHTPNSLLREYAPNVYGTPTTNGTFATGDGVKMARKLGATLVDMDKVQLHPTGLIDPKDPSNRTKYLGPEAL 720
gi 154344555  589 LATGGFSNDHTANSLLQQYAPQLSSFPTTNGVWATGDGVKAARELGVELVDMDKVQLHPTGLLDPKDPSNRTKYLGPEAL 668
gi 154344505  641 LATGGFSNDQTVNSLLREYAPNVYGTPTTNGAFATGDGVKMARQLGARLVDMDKVQLHPTGLIDPKDPSNRTKYLGPEAL 720
                         730       740       750       760       770       780       790       800
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72547207   721 RGSGGILLNKNGERFVNELDLRSVVSQAIIAQDNEYPNSGGSKFAYCVLNEEAATLFGKNSLTYYWKSQGLFTRVDDMKA 800
gi 71410008   740 RGSGGVLLNKKGERFVNELELRSVVSNAIIEQGDEYPYSGGSKFAFCVLNDAAVKLFGVNLLNFYANTLGVFKRVDDLQG 819
gi 71400421   664 RGSGGVLLNKKGERFVNELDLRSVVSNAIIEQGDEYPDAGGSKFAFCVLNDAAVKLFGVNSHGFYWKRLGLFVKADTVEK 743
gi 71747118   758 RGSGGILLNKQGKRFVNELDLRSVVSKAINTQGNEYPGSGGCYFAYCVLNEDATNLFGGGALGFYGKKLGLFQRAETVEE 837
gi 72388944   663 RGSGGVLLNKQGKRFVNELDLRSVVSKAIMEQGAEYPGSGGSMFAYCVLNAAAQKLFGVSSHEFYWKKMGLFVKADTMRD 742
gi 72547417   669 RGSGGVLLNKNGERFVNELDLRSVVSQAIIAQDNVYPGSGGSKFAYCVLNETAAKLFGKNFLGFYWNRLGLFQKSDSVAG 748
gi 146100731  669 RGSGGVLLNKNGERFVNELDLRSVVSQAIIAQDNVYPGSGGSKFAYCVLNETAAKLFGKNFLGFYWNRLGLFQKVDSVAG 748
gi 146100590  721 RGSGGILLNKNGERFVNELDLRSVVSQAIIAQDNEYPNSGGSKFAYCVLSEEAATLFGKNSLTYYWKSQGLFTRVDDMKA 800
gi 154344555  669 RGSGGVLLNKNGERFVNELDLRSVVSQAIIEQNNVYPGSGGSKFAYCVLNEAAAKLFGKNFLGFYWHRLGLFEKVEDVAG 748
gi 154344505  721 RGSGGILLNRNGERFVNELDLRSVVSQAINAQDDEYPNSGGSKFAYCVLSEEAAKLFGKNALTYYWKSQGLFTRVDNIKA 800
                         810       820       830       840       850       860       870       880
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72547207   801 LAELIGCSVESLHRTLETYERQSTGK-KACPLTGKLVFPSVVGTKGPYYVAYVTPSIHYTMGGCFISPAAELLMEDHSV- 878
gi 71410008   820 LAMLIGCDVLTLQNTLETYESSSIVT-SACPFTGKVVYPCVVGPQGPFYVAFVTPSIHYTMGGCLISPSAEIQREHYSL- 897
gi 71400421   744 LAALIGCPVENVRNTLGDYEQLSKEN-RQCPKTRKVVYPCVVGPQGPFYVAFVTPSIHYTMGGCLISPSAEMQLEENTT- 821
gi 71747118   838 LAKLIGCDEGELRDTLEKYETCSKAK-VACPVTGKVVFPCVVGTRGPYNVAFVTPSIHYTMGGCLISPAAEVLQEYKGL- 915
gi 72388944   743 LAALIGCPVESVQQTLEEYERLSTSQ-RSCPITRKSVYPCVLGTKGPYYVAFVTPSIHYTMGGCLISPSAEIQMKNTSSr 821
gi 72547417   749 LAKLIGCPEANVMATLKQYEELSSKKlNPCPLTGKNVFPCVLGTQGPYYVALITPSIHYTMGGCLISPSAEMQTKDNS-- 826
gi 146100731  749 LAKLIGCPEANVMATLKQYEELSSKKlNPCPLTGKNVFPCVLGTQGPYYVALVTPSIHYTMGGCLISPSAEMQTIDNS-- 826
gi 146100590  801 LAELIGCSVESLHRTLETYERQSTGK-KACPRTGKLVFPSVVGTKGPYYVAYVTPSIHYTMGGCFISPAAELLMEDHSV- 878
gi 154344555  749 LAKLIGCPEENVTATLKEYKELSSKKlHACPLTNKNVFPCTLGTEGPYYVAFVTPSIHYTMGGCLISPSAEMQTIDNT-- 826
gi 154344505  801 LAELIGCSVDNLHRTLETYEHQSTAK-VACPLTGKLVFPSVVGTSGPYYVAYVTPSIHYTMGGCSISPAAELLMEDHSV- 878
                         890       900       910       920       930       940       950       960
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72547207   879 NIFDDMRPILGLFGAGEVTGGVHGRNRLGGNSLLECVVFGKIAGDRAATILQKEKHGLSKDKWVPVVVRESRASDQFGVG 958
gi 71410008   898 NLLENQRPILGLFGAGEVTGGVHGGNRLGGNSLLECVVFGRIAGDRAATILQKQVYALSKDKWTSVVVRESRSGERFGTG 977
gi 71400421   822 SPFGHRRPIFGLFGAGEVTGGVHGGNRLGGNSLLECVVFGRIAGDRAATILQKKPVPLSFKTWTTVILREVREGGMYGTG 901
gi 71747118   916 NILENHRPIRCLFGAGEVTGGVHGGNRLGGNSLLECVVFGKIAGDRAATILQKREIALSKTSWTSVVVRESRSGEQFGTG 995
gi 72388944   822 APLSHSNPILGLFGAGEVTGGVHGGNRLGGNSLLECVVFGRIAGDRASTILQRKSSALSFKVWTTVVLREVREGGVYGAG 901
gi 72547417   827 GVTPVRRPILGLFGAGEVTGGVHGGNRLGGNSLLECVVFGKIAGDRAATILQKKNTGLSMTEWSTVVLREVREGGVYGAG 906
gi 146100731  827 GVTPVRRPILGLFGAGEVTGGVHGGNRLGGNSLLECVVFGKIAGDRAATILQKKSTGLSTTEWSTVVLREVREGGVYGAG 906
gi 146100590  879 NIFEDMHPILGLFGAGEVTGGVHGRNRLGGNSLLECVVFGKIAGDRAATILQKEKHGLRKDKWVPVVVRESRASDQFGVG 958
gi 154344555  827 GVTPVRRPILGLFGAGEVTGGVHGGNRLGGNSLLECVVFGRIAGDRAATILQKKNAGLSMTEWSTVVLREVREGGVYGTG 906
gi 154344505  879 NIFEDMRPILGLFGAGEVTGGVHGRNRLGGNSLLECVVFGKIAGDRAATILQKEKYGLSKDKWVPVVVRETRASDQFGVG 958
                         970       980       990      1000      1010      1020      1030      1040
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72547207   959 SRVLRFNLPGATQTSGLTVGEFIGIRGDWDGQQLIGYYSPINMPDDKGRISILARGDKGNLQEWISSMRPGDSVEMKACG 1038
gi 71410008   978 SRVLRFNLPGALQRSGLYLGQFIAIRGEWDGQQLIGYYSPITLPDERGVISILARGDKGTLKEWISAMRPGDSVEIKSCG 1057
gi 71400421   902 SRVLRFNLPGALQRSGLQLGQFIAIRGEWDGQQLIGYYSPITLPDDLGVIGILARSDKGTLKEWISALEPGDAVEMKGCG 981
gi 71747118   996 SRVLRFNLPGALQRTGLNLGEFVAIRGEWDGQQLVGYFSPITLPEDLGTISLLVRADKGTLKEWICALRPGDSVEIKACG 1075
gi 72388944   902 SRVLRFNLPGALQRSGLSLGQFIAIRGDWDGQQLIGYYSPITLPDDLGMIDILARSDKGTLREWISALEPGDAVEMKACG 981
gi 72547417   907 SRVLRFNMPGALQKTGLALGQFIGIRGDWDGHRLIGYYSPITLPDDVGVIGILARADKGRLAEWISALQPGDAVEMKACG 986
gi 146100731  907 SRVLRFNMPGALQRTGLALGQFIGIRGDWDGHRLIGYYSPITLPDDVGVIGILARADKGRLAEWISALQPGDAVEMKACG 986
gi 146100590  959 SRVLRFNLPGATQTSGLTVGEFIGIRGDWDGQQLIGYYSPINMPDDKGRISILARGDKGNLQEWISSMRPGDSVEMKACG 1038
gi 154344555  907 SRVLRFNMPGALQKTGLALGQFIAMRGDWDGQQLLGYYSPITLPDDIGVIGILARADKGRLAEWISALQPGDAVEMKACG 986
gi 154344505  959 SRVLHFNLPGATQTSGLTVGEFISIRGDWDGQHLIGYYSPISMPDDKGRISILARGDKGNLQEWVSSMRPGDSVEMKACG 1038
                        1050      1060      1070      1080      1090      1100      1110      1120
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 72547207  1039 GLRIELKPHQKQMVYRKTVIRKLGLIAGGSGVAPMLQIIKAALNRPYVDSIETIRLVYAAEDEYELTYRLLLKQYRTD-N 1117
gi 71410008  1058 GILIERNPAKKQFLFHGHVIRQFGLIAGGSGVAPMLQIIRAALERPYVDTTESIRLVYTAEEYEELTYRELLHHYSKE-N 1136
gi 71400421   982 GLVIERRFSERYLYFSGHALKKLCLIAGGTGVAPMLQIIRAALKKPFLENIESIRLIYAAEDVSELTYRELLEHHQRD-S 1060
gi 71747118  1076 GLRIDQDPVKKCLLFRNRPITRFALVAAGTGVAPMLQVIRAALKKPYVDTLESIRLIYAAEEYDTLTYRSILQRFAEE-F 1154
gi 72388944   982 GLVIERRLSDKHFVFMGHIINKLCLIAGGTGVAPMLQIIKAAFMKPFIDTLESVHLIYAAEDVTELTYREVLEERRRE-S 1060
gi 72547417   987 GLIIERRFADRHFFFRGHKIRKLALIGGGTGVAPMLQIVRAAVKKPFVDSIESIQFIYAAEDVSELTYRTLLESYEKEyG 1066
gi 146100731  987 GLIIERRFADRHFFFRGHKIRKLALIGGGTGVAPMLQIVRAAVKKPFVDSIESIQFIYAAEDVSELTYRTLLESYEKEyG 1066
gi 146100590 1039 GLRIELKPHQKQMVYRKTVIRKLGLIAGGSGVAPMLQIIKAALNRPYVDSIETIRLVYAAEDEYELTYRSLLKQYRAD-N 1117
gi 154344555  987 GLIIHRRFAARHLFFRSHKIRKLALIGGGTGVAPMLQIVRAAVKKPFVDSIESIQFIYAAEDVSELTYRTLLESYEKEyG 1066
gi 154344505 1039 GLRIELKPQQKQMIYRKTVIRKLALIAGGSGVAPMLQIIKAALSRPYVDSIETIRLVYAAEDEYELTYRSLLKKYRTD-N 1117
                        1130      1140      1150      1160      1170      1180      1190
                  ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*..
gi 72547207  1118 PGKFDCGFVLNNPPEGWTEGVGYVDRATLQSLLPPPSKGLLVAICGPPVMQRSVVADLLALGYNAEMVRTVDEDGAL 1194
gi 71410008  1137 PDKFSVEFSLNNPPEGWTGGVGFVDRPSLRKTLQPPSNDLLIAICGPPAMQRAMKNDLLAMGYNPALVHTVDDDMQA 1213
gi 71400421  1061 KGKFRSIFVLNRPPPIWTDGVGFIDKKLLSSSVQPPAKDLLVAICGPPIMQRVVKTCLKSLGYDMQLVRTVDEVETQ 1137
gi 71747118  1155 PDKFVCNFVLNNPPEGWTGGVGFVNKKSLQKVLQPPSSEPLIVVCGPPVMQRDVKNELLSMGYDKELVHTVDGESGT 1231
gi 72388944  1061 RGKFKKTFVLNRPPPLWTDGVGFIDRGILTNHVQPPSDNLLVAICGPPVMQRIVKATLKTLGYNMNLVRTVDETEPS 1137
gi 72547417  1067 SEKFKCHFVLNNPPAQWTDGVGFVDTALLRSAVQAPSNDLLVAICGPPIMQRAVKGALKSLGYNMNLVRTVDETEPT 1143
gi 146100731 1067 SEKFKCHFVLNNPPAQWTDGVGFVDTALLRSAVQAPSNDLLVAICGPPIMQRAVKGALKGLGYNMNLVRTVDETEPT 1143
gi 146100590 1118 PDKFDCGFVLNNPPEGWTEGVGYVDRATLQSLLPPPSKGLLVAICGPPVMQRSVVADLLALGYNAEMVRTVDEDGAL 1194
gi 154344555 1067 SGKFKCHFVLNNPPSQWTEGVGFVDTALLRSAVQAPSNDLLVAICGPPIMQRAVKSALKGLGYNMNLVRTVDEPEPL 1143
gi 154344505 1118 TEKFDCDFVLNNPPEGWTEGVGYVDRATLQSFLPPPSKGLLVAICGPPVMQHSVVADLLALGYSAETVRTIDEDRML 1194
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap