Conserved Protein Domain Family
PTZ00307

?
PTZ00307: PTZ00307 
ethanolamine phosphotransferase; Provisional
Statistics
?
PSSM-Id: 140328
View PSSM: PTZ00307
Aligned: 5 rows
Threshold Bit Score: 645.738
Threshold Setting Gi: 71654658
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146105060   1 MPRKSTARHESINPLENEYIPPAYLPNLRKYKYSSTDLSIVSRYVLQRYWNFVVNLVPMTVAPNCITFTGFLIGMSSTAL 80
gi 71748118   17 GPGSHRSRCISLDPRVHEHIPPHFLPNLAKYKYSGSDSGIISNYVMQPYWNFIVSLVPMTVAPNAITVTGFVMCLSSALL 96
gi 71654658   23 GPPH--PRRISLNPIVHEHIPPDYLSNLKKYKYSGSDSSIIARYVMQPYWNFIVSLVPMTVAPNAITLTGFLIGLSSSIL 100
gi 154346592   1 MPPKMTARRKSLNPLENEYIPPAYLPNLKKYKYSSTDFSIMSRYVLQRYWNFLVNLVPMTVAPNCITFTGFLIGMSSAVM 80
gi 157877757   1 MPPKSMARQESINPLENEYIPPAYLPNLRKYKYSSTDLSIVSRYVLQRYWNFVVNLVPMTIAPNCITFTGFLIGMSSTAL 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146105060  81 LLYYYFFEGGVYPSWCLYYAAFALFAYQTLDAIDGKQARRTGTGSPLGELFDHGCDAFLTPFVLLNVSLATYMTPVERFW 160
gi 71748118   97 VMFFYYFGNAEYPCWVWLYAVICLFAYQTLDAIDGKQARRTNTGSPLGELFDHGCDVILTPFVQMMICCALNTPPCVTFV 176
gi 71654658  101 VMFFFFFYDAVYPAWVWYYAAAALFIYQTLDAVDGKQARRTQTCGPLGELFDHGCDAFLTPLVQVILCCALDLPSWMTFA 180
gi 154346592  81 LLYFFFFEEGVYPSWSLYYASFALFTYQTLDAIDGKQARRTGTGSPLGELFDHGCDAFLTPFVLLNVSLVTYMTPVERFW 160
gi 157877757  81 LLYYYFFEEGVYPSWCLYYAAFALFAYQTLDAIDGKQARRTGTGSPLGELFDHGCDAFLTPLVLLNVSLATYMTSVERFW 160
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146105060 161 LSTISSMSLFTVIWEQFSTGTFDLGYVNGPAEGIILNCVLFIVSGVYGESIWDTSAVGPYDVAyppvLSRFFPGCNGTVH 240
gi 71748118  177 YITLSSCAVFGAIWEQFVTGTLDFGYVNGPTDGILLACGIFLITAIMSPAVWDTQVAGPYEVP----LPSWLGSCGGSFV 252
gi 71654658  181 YSTMSSIVLFCAIWEQFSTGTLDLGYINGPTEGIFMACILFIITGLYSTSIWDTPVISPYELK----ISFFYGEVS--FV 254
gi 154346592 161 LLSFSSFSLFTIIWEQFSTGVFVLGYVNGPTEGIILNCVLFIVSGVYGESIWDTPAVGPYDVAyppaLAWLFPGSSGVVH 240
gi 157877757 161 LSTISSMSLFTVIWEQFSTGTFDLGYVNGPAEGIILNCVLFIVSGVYGKSIWDISAVGPYDVAyppvLSPFFPGCSGTVH 240
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146105060 241 IESVRSVLFILFLVSCPFTILVNVVHAVLRPTVHASKvMPMLALAPIVTMTALAVHVFVVFPNLTVRFPFAMEISYGLLM 320
gi 71748118  253 IGSVRSMLFTFYVVSGTLTLLTNILHVLKRPNIQKPG-MAVTTALPVVCLLVLHVWMYLVYRPIHEKYPYALELSFHVLI 331
gi 71654658  255 IFTLRSLIFLYITVAACLTVGANIVHVVGRPGVHVKG-TPFFVMLPMLFLLFFHVCLFLTYTSIHDKYPFAFELSFGFLT 333
gi 154346592 241 IESIRSVLFLIFLIFCLFTILTNVIHVVVRPTVHDSKvTPMLAAVPILSMTALMVHVSVVFSNLKVHFPFALEMSYGLLV 320
gi 157877757 241 IESVRSVLFILFLISCPFTILVNVVHTVLRPTVHASKvTPMLALAPIITMTALVVHVFVVFPNLTVRFPFAMEISYGLLM 320
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 146105060 321 SITVTRLTLARLSAMPYRTVNWHIVFFFVaLAAASAMHYAGDAAVSHDLVETLLGWTLTGLAVFAAMQYGHMILSAFTQI 400
gi 71748118  332 SYTATRMTVSRLCAMPFNLFSGLFIITLL-FTVAPLFIHTYLPLAEEKYVLPSLGSATVALAVLGFWQYFHMILSVITQM 410
gi 71654658  334 SYTVTRMTVARLCAMPYSLFNAFYLITFC-VTFGALVVHAHFRQIEIKYLEPSLGSAMVALAALGVWQYLHMILSLFTQI 412
gi 154346592 321 SITVTRLTLARLSLMPYKTTNWHIVLLFIaLTTASVLHYAGNASVPHEVVERVLGWSLTGLSVFAAVQYGHMILSAFTQI 400
gi 157877757 321 SITVTRLTLSRLSAMPYRTVNWHIVLFFLaLAAASAMHYAGDASVSHDVVETVLGWTLTGLSVFAAMQYGHMILSAFTQI 400
                        410
                 ....*....|....*..
gi 146105060 401 ARYLSISIMTIKPNKSD 417
gi 71748118  411 AYFLRISVFSITSRHDS 427
gi 71654658  413 SYYLGVPLLSITSREEK 429
gi 154346592 401 ARYLNISIMSIKPKKSD 417
gi 157877757 401 ARYLSISIMTIKPNKSD 417
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap