Conserved Protein Domain Family
PTZ00312

?
PTZ00312: PTZ00312 
inositol-1,4,5-triphosphate 5-phosphatase; Provisional
Statistics
?
PSSM-Id: 140333
View PSSM: PTZ00312
Aligned: 6 rows
Threshold Bit Score: 592.635
Threshold Setting Gi: 157865726
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154333514   1 MDEREggdmvsssshprhrptnavqaqrrlsfegtnassnngdtngqvsgrgvDANRpsnasytgtdliseldvnadafF 80
gi 71658997  223 METNS------------------------------------------------DMQR----------------------F 232
gi 71666492  219 METNS------------------------------------------------DMQR----------------------F 228
gi 71755573  225 MRAND------------------------------------------------DEDQ----------------------F 234
gi 146079913 229 MDEREsgdtlsssnyqrhraastvqal----rrtsfegssssnnngsanghagDAHRlsdansndtdltaeldagadayF 304
gi 157865726 229 MDEREsgdtlssssyqrhratstvqal----rrtsfegsstsnnngnanghvgDAHRlsdansndtdltaeldadadayF 304
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154333514  81 TAIGSIVFLSPRIMGIASCLSIPHRTYIPVVDDPLTYAGEAGRLFHSGKFAEAGRSRKGFLLLSLRFGTVQFNVCNVHLF 160
gi 71658997  233 TALGSIVFLSSRMCPISSILSFRHRTFVAVADDPATYGSSPTFLFHGGKFSGAGSGRKGFLLTSLRFGTVVVNYLNVHLY 312
gi 71666492  229 TALGSIVFLSSRMCPISSILSFRHRTFVAVADDPATYGSSPTFLFHGGKFSGAGSGRKGFLLTSLRFGTVVVNYLNVHLY 308
gi 71755573  235 TAVGSVVYLSHRMCPISSILSFHHRTFVCVGDDPVTYGSSPTILFHGGKFSGAGESRKGYLLISLRLGTVVVNFLNVHLY 314
gi 146079913 305 TAIGSIVFLSPRVMGIASCLSVPHRTYIPIVDDPLTYAGEAGRLFHSGKFAEAGRSRKGFLLLSLRLGTVHFNVCNVHLF 384
gi 157865726 305 TAIGSIVFLSPRFMGIASCLSVPHRTYIPIVDDPLTYAGEAGRLFHSGKFAEAGRSRKGFLLLSLRLGTVQFNVCNVHLF 384
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154333514 161 HDDDNRVALASSPSPYTGRRARAMKEAIAECSAVVDLSEPLFIFGDYNVRLDGKLLAEWVEEKMQVTVRPEKKRLRCPEH 240
gi 71658997  313 HDSRNTDAAMTSPSLYSVQRQEALLEAMAECMVFISPEDPLFIFGDFNARLDTHNLLKHLKETQQIDVKILVKEVQAPDR 392
gi 71666492  309 HDSRNTDAAMASPSLYSVQRQEALLEAMAECMVFISPEDPLFIFGDFNARLDTHNLLKHLKETQQIDVKILVKEVQAPDR 388
gi 71755573  315 NDKKSKEAAAASPSPYALQRQEALLETLAECAAFISPDDPLFIFGDFNTRLDVHNMLQYLKEVENLDVKVSDGDVRAPDS 394
gi 146079913 385 NDDDNRVALKSSPSLYTGRRARALKEAIAECSAVVDLSEPLFIFGDYNVRLDGKSFAEWVEEKMQMTVRAEKKRLRCPEQ 464
gi 157865726 385 NDDDNRVALKSSPSLYTGRRTRAITEAIAECSAVVDLSEPLFIFGDYNVRMDGKSFTEWVEEKMQMTVRAERKRLRCPEQ 464
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154333514 241 FWELFTDPDTQKELRtRFDAELQHLMNEVALLSSVELAEMPIHFAPTYFRVAHR----TPTGAAVTSAAATSAAAVATTQ 316
gi 71658997  393 FWELFTEPQNAGMIK-KFDLELQRLMDVVAQQSGVELAEFAIRFPPTFPRIPERefakSNQKQQIEMSGGNVEASEYGVK 471
gi 71666492  389 FWELFTEPQNAGMIK-KFDLELQRLMDVVAQQSGVELAEFAIRFPPTFPRIPERefakSNQKQQIEMSGVNVEASEYGVK 467
gi 71755573  395 FWELFENPQHMGVIR-PYDVEVQRLLDVVAQQSGMELAEFAVRFPPTYL---------CQSPRDSEEATFQIDTPVHLVN 464
gi 146079913 465 FWELFTDPATQQELRkRFDIEPQHLMDEVALLSSVELAEMPIQFAPTYSRVAYR----TRTGATTTSAGADAAA----LR 536
gi 157865726 465 FWELFTNPATQQELRtRFDIEPQHLMDEVALLSSVELAEMPIQFAPTYSRVAYR----TRTGATTTSAGADAAA----LR 536
                        330       340       350       360       370       380       390       400
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154333514 317 NVAATADTQQPTSASNDLVGRADVisveeqeqtegvrv-rpplsapplpkatLANVPLTHVTASPYRdNFCHDRLPAWCD 395
gi 71658997  472 DDDPKLGNERRKKAARKEKGTGEA----------------------------KPSLVLPRITAIPTR-GYTRRRIPAWCD 522
gi 71666492  468 DDDPKLGNERRKKAAGKEKGTGEA----------------------------KPSLVLPRITAIPTR-GYTRQRIPAWCD 518
gi 71755573  465 DGEDKRES-----------GTSDRi---------------------------SVVRVLERLSSIPHH-PYGRRRVPAWCD 505
gi 146079913 537 DVAATPDAQQQIPTSKDLAGRADAiraeeqeqaeairvrpslstplpssmspLASVPLTHVTASPHRdNFCHDRLPAWCD 616
gi 157865726 537 DVAATPDAQQQIPTLKDLAGRADAiraeeqeqteairarpsvstllaplaspLASVPLTHVAASPYRdNFCHDRLPAWCD 616
                        410       420       430       440       450       460       470
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|..
gi 154333514 396 RVLFNVAGLEWIAGDRARSAHPQTQAAssvlgnavsgsdglKGKQCSDQSCWHAYASIDLIHTDHDGVFILF 467
gi 71658997  523 RVVWNPAGLELMTGQRSLPPSVSSALV--------------KSDGATDSSPRYAYRSFVLAHTDHDCVGLLF 580
gi 71666492  519 RVVWNPAGLELMTGQRSLSPSVSSALG--------------KSDGATDSSPRYAYRSFVLAHTDHDCVALLF 576
gi 71755573  506 RVLWNPPALELMTGRRTSQSVAGSSATa-------------HGGTGVGALRRYVYRSVALRHTDHAAVTLFF 564
gi 146079913 617 RVMFNVAGLEWISGDRSRTAPPQPHAAssvpgsaasgagclKGRQRSGQSCWYAYAAIDLIHTDHDGVFMLF 688
gi 157865726 617 RVMFNVAGLEWISGDRSRTAPPQPQAAssvsgsaasgagglKGRQRSGQGCWYAYAAIDFIHMDHDGVFMLF 688
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap