Conserved Protein Domain Family
PTZ00313

?
PTZ00313: PTZ00313 
inosine-adenosine-guanosine-nucleoside hydrolase; Provisional
Statistics
?
PSSM-Id: 140334
View PSSM: PTZ00313
Aligned: 6 rows
Threshold Bit Score: 611.482
Threshold Setting Gi: 72386929
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73537053    2 PPKPVIIDHDGGHDDLVALALLLGNPEAVKVIGCIVTDADCFVDQAFSVSGKLMAMMHAREATELFPVAKTSFKGVNPFP 81
gi 71404206    1 MPKAVILDQDGNHDDIISLALLLARPEKVRVIGCICTDADCFVADAFNITGKLMCLLNKRANRPLFPIGISSLHGVNPFP 80
gi 71660754    1 MPKAVILDQDGNHDDIISLALLLAWPEKVSVIGCICTDADCFVADAFNITGKLMCLLNKRANRPLFPIGISSFHGVNPFP 80
gi 72386929    1 MAKTVILDHDGNKDDFVAMILLLSNPKKVNLIGCICTDADCFVENGFDVTGKIMCAMHRLIKTPLFPIGKSTATAVNAFP 80
gi 146093393   2 PPKPVIIDHDGGHDDLVALALLLGNPEAVKVIGCIVTDADCFVDQAFNVSGKLMAMMHAREATELFPVAKTSFKGVNPFP 81
gi 154341348   2 SPKPVIIDHDGGHDDLVALALLLGNPESVKVIGCIVTDADCIVDHAFSVSGKLMAMMHATEATGLFPVAKTSFKGVNPFP 81
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73537053   82 SEWRWSAKNMDDLPCVNIPEHVAIWEAVRDENDALVGEEVMAQLVMSSPEKVTICVTGPLSCVAWCIDKYGEEFCKNVEE 161
gi 71404206   81 MEWRCTAKNMDDLPSLNIPEHTEMWEKLKPEYEKLVGEELLADLVMNSPEKVTICVTGPLSNVAWCIDKYGRRFTDKVEE 160
gi 71660754   81 MEWRCSAKNMDDLPSLNIPEHTEMWEKLKPEYEKLVGEELLADLVMNSPEKVTICVTGPLSNVAWCIEKYGRRFTDKVEE 160
gi 72386929   81 TEWRFSAKNLDDMPFLNIVEDVALWEKLKPENEAHNGQQLLADLVMKSKEKVTVCVTGPLSNMAWCIEKYGEAFTSKVEE 160
gi 146093393  82 SDWRWSAKNMDDLPCVNIPEHVAIWEAVRDENDKLVGEEAMAQLVMSSPEKVTICVTGPLSCVAWCIGRYGEEFCKNVEE 161
gi 154341348  82 SEWRWSAKNMDDLPCVNIPEHVTIWNSVRDQNDALVGEEVMAQLVMSSPEKVIICVTGPLSCVAWCIEKYGEEFCKNVEE 161
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73537053  162 CIIMGGAVDVKGNVFIDGrTDGSAEWNIFWDPVAAKTVLTYPHLKKIVFSLDSTNSVPVTSEVVQKFGAQNKYLLSQFVG 241
gi 71404206  161 CVIMGGAVDVGGNVFLPG-TDGTAEWNIYWDPPAAKAVLECPHIRNVLFSLNSTNAVPVCSSLVKRFGAQNEYLLSQFVG 239
gi 71660754  161 CVIMGGAVDVGGNVFLPG-TDGTAEWNIYWDPPAAKTVLECPHIRNVLFSLNSTNTVPVCSSLVKRFGAQNEYLLSQFVG 239
gi 72386929  161 CVIMGGAVDVGGNVFLPT-TDGSAEWNIYWDPPAAKKVLCCPNIRCVLFSLDATNTVPVRSVDVKGFGAQNQYLLSQMVG 239
gi 146093393 162 CIIMGGAVDVKGNVFIEGrTDGSAEWNIFWDPAAAKTVLMCPHLKKIVFSLDSTNSVPVTSEVVQKFGAQNKYLLSQFIG 241
gi 154341348 162 CVIMGGAVDVKGNVFIDGrTDGSAEWNIFWDPAAANTVLMCPHLKKIIFSLDSTNSVPVTSEVVQKFGAQNKYLLSQFVA 241
                        250       260       270       280       290       300       310       320
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 73537053  242 SAWASCTHFELIRPGDMYYAWDVLTAAYAIEQRLAELEAVPLDVVVEaNAPNEGQTRRAA-EGAAVknTYVAKNTNADMF 320
gi 71404206  240 STWAMCTHHELLRPGDGYYAWDSLTAAYVIDNNLADLEPMTLEVEIN-KTKDEGRTFRST-QGRTC--TYVAKNTNAELF 315
gi 71660754  240 STWAMCTHHVLLRPGDGYYAWDSLTAAYVIDNNLADLEPMALEVEIN-KTKDEGRTFRST-QGRTC--TYVAKNTNAELF 315
gi 72386929  240 TMWAMSTHEEILRDGDAYYAWDALTAAYILEPTIATLEPVALDVDVS-KGKSEGRTPRASgEGKPC--VHVARNPSKQMF 316
gi 146093393 242 SAWASCTHFELIRPSDGYYAWDVLTAAYAIERRLAELEAVPLEVVVEaNAPNEGQTRRAF-EGAALdhTYVAKNTKTDLF 320
gi 154341348 242 STWASCTHVELLNPGNGYYAWDVLTAAYVIDRGLAEVEAVPLEVVVEaNAPNEGQIRRAA-DGAALrnTYLAKNTNAELF 320
                        330
                 ....*....|.
gi 73537053  321 YRMVMDTARCC 331
gi 71404206  316 YDMVLSSMRIC 326
gi 71660754  316 YDMVLSSMRIC 326
gi 72386929  317 HDLVFASTRVC 327
gi 146093393 321 YRMVMDSARCC 331
gi 154341348 321 YRLALDSARRS 331
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap