Conserved Protein Domain Family
PTZ00316

?
PTZ00316: PTZ00316 
profilin; Provisional
Statistics
?
PSSM-Id: 140337
View PSSM: PTZ00316
Aligned: 6 rows
Threshold Bit Score: 299.58
Threshold Setting Gi: 71410417
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71400168    1 MSWQAYIDDSLIGSGHMHSAAIVGLSDGSYWGYGGNYIPQPDEVAHILKCLGNFSLVQSSGVTIYGVKFFGLQSGEEGEM 80
gi 71410417    1 MSWQAYIDDSLIGSGHMHSAAIVGLSDGSYWGYGGTYIPQPDEVAHILKCLGNFSLVQSSGVTIYGVKFFGLQSGEEGEM 80
gi 74025736    1 MSWQSYVDDSLVGSGFMHSAAIVGLADGSYWAYGGTYVPQPEEVTHILKCLENFSLVQSSGVTICGVKFFGLQSGSEGQM 80
gi 146096265   1 MSWQAYVDDSLIGSGNMHSAAIIGAADGSYWAYGGSYVPQPEEVQHIQKCLSDFSLVQSSGVNIYGVKFFGLQCGTDGDC 80
gi 154342939   1 MSWQAYVDDSLIGSGNMHSAAIIGAADGSYWAYGGSYIPQPEEVKHIQKCLADFSLVQSSGVTIYGVKFFGLQCGTDGDT 80
gi 157873725   1 MSWQAYVDDSLIGSGNMHSAAIIGAADGSYWAYGGSYVPQPEEVQHIQKCLSDFSFVQSSGVNIYGVKFFGLQCGTDGDC 80
                         90       100       110       120       130       140       150
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71400168   81 KYIFFKKGAAGGCIYTSKQTAIIAVYGNPGTSSSLQQDLEKKEGAEIAVNPADCNSTVKRIAEYLISLDY 150
gi 71410417   81 KYIFFKKGAAGGCIYTSKQTAIIAVYGNPGTSSSLQQDLEKKEGAEIAVNPADCNSTVKRIAEYLISLDY 150
gi 74025736   81 KYIFFKKGAAGGCIYTSKQTAIIAVYGNPGDASALQQDLQKTEATYVAVNPADCNTTVKRIAEYLISLDY 150
gi 146096265  81 KYIFFKKGAAGGCIYTTKQAFIVAVYGNPGDTSSLQQDLEKNTAHTVTVNPADCNTTVKRIADYLIKLGY 150
gi 154342939  81 KHIFFKKGAAGGCIYTTKQAFIVAVYGDPGDTSSLQQALAKNASHAAAVNPADCNTTVKRIADYLVKLGY 150
gi 157873725  81 KYIFFKKGAAGGCIYTTKQAFIVAVYGNPGDTSSLQQDLEKNTAHAVTVNPADCNTTVKRIADYLIKLGY 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap