Conserved Protein Domain Family
PTZ00320

?
PTZ00320: PTZ00320 
ribosomal protein L14; Provisional
Statistics
?
PSSM-Id: 140341
View PSSM: PTZ00320
Aligned: 6 rows
Threshold Bit Score: 346.254
Threshold Setting Gi: 72387638
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154336773   1 MLRLFRARLAPT-TTDAAAKLPAGNPVNKTWFRHNLIIRRKGSYRSRWGNGTEGYGAGVPLSDQVKLHCVDNTNCKHVRL 79
gi 71395987    1 MFRRWGLRLAAT-TTDAAAKLPAGNPVNKSWFRYNLIIRRKASYRSRWGTGAEGYGTGVPFSDQVKLHCVDNTNCKHVRL 79
gi 71663945    1 MFRRWGLRLAAT-TTDAAAKLPAGNPVNKSWFRYNLIIRRKASYRSRWGTGAEGYGTGVPFSDQVKLHCVDNTNCKHVRL 79
gi 72387638    1 MFRFFSLRLAPApSADAAAKLPAGKPANKSWFRHNLIIRRKASYRSRWGTGAEGYGTGVPFSDQVKLHCVDNTNCKHVRL 80
gi 146099698   1 MLRFFRARLAPT-TTDAAAKLPAGNPVNKTWFRHNLIIRRKGSYRSRWGNGTEGYGAGVPLSDQVKLHCVDNTNCKHVRL 79
gi 157876257   1 MLRFFRARLAPT-TTDAAAKLPAGNPVNKTWFRHNLIIRRKGSYRSRWGNGTEGYGAGVPLSDQVKLHCVDNTNCKHVRL 79
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 154336773  80 IAKATAERFAHCRVFPAVAHRVSVQRFKgrGGGGEVSRHRVKPGNIYWVCLFTRRQTNTRMSGLQTNFDRNTCIIMNDQR 159
gi 71395987   80 ISKATAERFAHCRVFPAVAHRVSVQRFK--SGRGEVSRHRVKPGNIYWVCLLSRRQTNTRMSGLQTNFDRNTCILLNDQR 157
gi 71663945   80 ISKATAERFAHCRVFPAVAHRVSVQRFK--SGRGEVSRHRVKPGNIYWVCLLSRRQTNTRMSGLQTNFDRNTCILLNDQR 157
gi 72387638   81 ISKATAERFAHCRVFPAVAHRVSVQRFK--SGRGEVSRHRVKPGNIYWVCLLSRRQTNTRMSGLRTNFDRNTCILMNDQR 158
gi 146099698  80 IAKATAERFAHCRVFPAVAHRVSVQRFKgrGRGGEVSRHRVKPGNIYWVCLFTRRQTNTRMSGLQTNFDRNTCIIMNDQR 159
gi 157876257  80 IAKATAERFAHCRVFPAVAHRVSVQRFKgrGGGGEVSRHRVKPGNIYWVCLFTRRQTNTRMSGLQTNFDRNTCIIMNDQR 159
                        170       180       190
                 ....*....|....*....|....*....|.
gi 154336773 160 VPLGTRVMYCAGRHVNHKYHLKAVVLANFFV 190
gi 71395987  158 VPLGTRVMYCAGRHVNHKYHLKAVVLANFFI 188
gi 71663945  158 VPLGTRVMYCAGRHVNHKYHLKAVVLANFFI 188
gi 72387638  159 VPLGTRVMYCAGRHVNHKYHLKAVVLANFFV 189
gi 146099698 160 VPLGTRVMYCAGRHVNHKYHLKAVVLANFFV 190
gi 157876257 160 VPLGTRVMYCAGRHVNHKYHLKAVVLANFFV 190
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap