Conserved Protein Domain Family
PTZ00328

?
PTZ00328: PTZ00328 
eukaryotic initiation factor 5a; Provisional
Statistics
?
PSSM-Id: 140349
View PSSM: PTZ00328
Aligned: 11 rows
Threshold Bit Score: 337.411
Threshold Setting Gi: 154338682
Created: 9-Dec-2010
Updated: 22-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71659671    1 MSDDEGNFTQQGGEQTGSLTYPMQAGALKKGGYICINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNKMEDQAPTTH 80
gi 71659667    1 MSDDEGNFTQQGGEQTGSLTYPMQAGALKKGGYICINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNKMEDQAPTTH 80
gi 71754505    1 MSDDEGQFA-EGGAQVGSLTYPMQAGALKKGGYICINGRPCKVIDLSVSKTGKHGHAKVSIVALDIFTGNKMEDQAPSTH 79
gi 146088631   1 MSDEDHDFSHQGGGDNASKTYPLPAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 80
gi 146088636  92 MSDEDHDFSHQGGGDNASKTYPLPAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 171
gi 154338682   1 MSDEDHDFSHQGGGDNASKTYPLAAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 80
gi 154338684   1 MSDEDHDFSHQGGGDNASKTYPLAAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 80
gi 154338686   1 MSDEDHDFSHQGGGDNASKTYPLAAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 80
gi 154338688   1 MSDEDHDFSHQGGGDNASKTYPLAAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 80
gi 157870552   1 MSDEDHDFSHQGGGDNASKTYPLPAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 80
gi 157870554   1 MSDEDHDFSHQGGGDNASKTYPLPAGALKKGGYVCINGRPCKVIDLSVSKTGKHGHAKVSIVATDIFTGNRLEDQAPSTH 80
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 71659671   81 NVDVPFVKTSTYSVLDIQEDrTDPSKPAHLSLMDDEGETRDNLDMPPNAELAAQIKEQFEAGKDVLVVVVSAMGTDQILS 160
gi 71659667   81 NVDVPFVKTSTYSVLDIQEDrTDPSKPAHLSLMDDEGETRDNLDMPPNAELAAQIKEQFEAGKDVLVVVVSAMGTDQILS 160
gi 71754505   80 NVEVPFVKTATYSVLDIQEDrEDPSKPAHLSLMDDEGETRDNLDMPPNAELAGQIKEQFDAGKDVLVVVVSAMGIDQILS 159
gi 146088631  81 NVEVPFVKTFTYSVLDIQPN-EDPSLPSHLSLMDDEGESREDLDMPPDVALATQIKEQFDSGKEVLVVVVSAMGTEQVLQ 159
gi 146088636 172 NVEVPFVKTFTYSVLDIQPN-EDPSLPSHLSLMDDEGESREDLDMPPDVALATQIKEQFDSGKEVLVVVVSAMGTEQVLQ 250
gi 154338682  81 NVEVPFVKTYTYSVLDIQAN-EDPSLPAHLSLMDDEGESREDLDMPPDPALATQIKEQFDSGKEVLVVVVSAMGTEQVLQ 159
gi 154338684  81 NVEVPFVKTYTYSVLDIQAN-EDPSLPAHLSLMDDEGESREDLDMPPDPALATQIKEQFDSGKEVLVVVVSAMGTEQVLQ 159
gi 154338686  81 NVEVPFVKTYTYSVLDIQAN-EDPSLPAHLSLMDDEGESREDLDMPPDPALATQIKEQFDSGKEVLVVVVSAMGTEQVLQ 159
gi 154338688  81 NVEVPFVKTYTYSVLDIQAN-EDPSLPAHLSLMDDEGESREDLDMPPDPALATQIKEQFDSGKEVLVVVVSAMGTEQVLQ 159
gi 157870552  81 NVEVPFVKTFTYSVLDIQPN-EDSSLPSHLSLMDDEGESREDLDMPPDAALAAQIKEQFDSGKEVLVVVVSAMGTEQVLQ 159
gi 157870554  81 NVEVPFVKTFTYSVLDIQPN-EDSSLPSHLSLMDDEGESREDLDMPPDAALAAQIKEQFDSGKEVLVVVVSAMGTEQVLQ 159

                 ....*..
gi 71659671  161 FKNAVEK 167
gi 71659667  161 FKNAVEK 167
gi 71754505  160 FKNAAER 166
gi 146088631 160 TKNAAEK 166
gi 146088636 251 TKNAAEK 257
gi 154338682 160 TKNAAEK 166
gi 154338684 160 TKNAAEK 166
gi 154338686 160 TKNAAEK 166
gi 154338688 160 TKNAAEK 166
gi 157870552 160 TKNAAEK 166
gi 157870554 160 TKNAAEK 166
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap