2CMK


Conserved Protein Domain Family
cmk

?
TIGR00017: cmk 
Click on image for an interactive view with Cn3D
cytidylate kinase
This family consists of cytidylate kinase, which catalyzes the phosphorylation of cytidine 5-monophosphate (dCMP) to cytidine 5 -diphosphate (dCDP) in the presence of ATP or GTP. UMP and dCMP can also act as acceptors. [Purines, pyrimidines, nucleosides, and nucleotides, Nucleotide and nucleoside interconversions]
Statistics
?
PSSM-Id: 129128
View PSSM: TIGR00017
Aligned: 9 rows
Threshold Bit Score: 291.254
Threshold Setting Gi: 9910742
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                       10        20        30        40        50        60        70        80
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2CMK_A       4 IAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAA---LHHHVDVASEDALVPLASHLDVRFVSTNG--NL 78
gi 2506790   4 IAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAA---LHHHVDVASEDALVPLASHLDVRFVSTNG--NL 78
gi 1170627   1 --MIITVDGPSGAGKGTLCYALAEKLGYALLDSGAIYRVTALAA---LQRKTDLTNETDLAELARHLDIQFIPQNG--EV 73
gi 1346370   1 MNWQIAIDGPSSSGKSSVAKKIAEELDFFYFSSGKMYRAFAYVM---QVNRLNID---LFLKIINQINWRFEKDA----- 69
gi 2497488   1 MYFQIAIDGPSSSGKSSVAKTVARQLGFEYFSTGKMYRAFAYVM---QVNRLDVN---LLLKVINQINWRFEHEK----- 69
gi 9910742   1 --MIIAIDGPSASGKSSIARELGVRLNYKFISSGHLYRIITLIAqrsLMNSCDFISEDSLLNLILENDISFNNFA----- 73
gi 1574494  42 MGMIITVDGPSGAGKGTLCYALAEKLGYALLDSGAIYRVTALAA---LQRKTDLTNETDLAELARHLDIQFIPQNG--EV 116
gi 585351    3 KKLSIAIDGPAAAGKSTVAKIVAEKKSYIYIDTGAMYRAITYAA---LQENVDLTDEEKLAELLKRTDIELITTKD--GQ 77
gi 1174254   5 RLPIIAIDGPAGAGKSTVTRQVADGLGLTYLDTGAMYRALAWLI---LDQGIAPEDEPAVAELTSGAEIELMPRPApqLT 81
                       90       100       110       120       130       140       150       160
               ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
2CMK_A      79 EVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFREL--PGLIADGRDMGTVVFPDAPVKIFLDASSEERAH 156
gi 2506790  79 EVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFREL--PGLIADGRDMGTVVFPDAPVKIFLDASSEERAH 156
gi 1170627  74 SILLAGMDVSRLIRTQEVADAASKVAVFQKVRSALLQLQQDFAKN--DGLIADGRDMGTVVFPNAQVKLFLDASAEERAK 151
gi 1346370  70 -VYYNNADITTVITTQSVANIASKIAVDPNIRKIAVIKQQKLAEN--KNIVMDGRDIGTVVLKNAQLKFFLDAKVEIRAQ 146
gi 2497488  70 -VFYNNADISEVILNQEIAQLASNLATNPEVRKMAVLRQQALAKN--TNIVMDGRDIGTVVLKDAQLKYFLDAKPEIRAQ 146
gi 9910742  74 -FLLNGENVENQILNDKIDFQVSFYSSYVGIRNIVNKKLREVVKFsdDNYIIEGRDITTVVFPESEFKIYLDASVKVRAL 152
gi 1574494 117 NIFLAGMDVSRLIRTQEVADAASKVAVFQKVRSALLQLQQDFAKN--DGLIADGRDMGTVVFPNAQVKLFLDASAEERAK 194
gi 585351   78 KVFVNGTDVTEAIRTDEISNQVSIAAKHRSVREEMVKRQQQLGEK--GGVVMDGRDIGTHVLPNAEVKIFLLASVEERAK 155
gi 1174254  82 GVKVNGQDVSDAIRTPAVTQLVSTIAAQGAVRAKLLKLQRKYGDQ--GGIVAEGRDIGTQVFPNAELKIFLTASVQERAR 159
                      170       180       190       200       210       220
               ....*....|....*....|....*....|....*....|....*....|....*....|....*.
2CMK_A     157 RRMLQLQEKG-F-SVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYA 220
gi 2506790 157 RRMLQLQEKG-F-SVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYA 220
gi 1170627 152 RRYKQLQNKG-I-NGNFAQILAEIKERDFRDRNREVAPLKPADDALLLDSTTLSIDEVIDQALAYI 215
gi 1346370 147 RRLQDMGISLsN-EKKLKELIQELKQRDQIDSSRTADPLKKAQDAIYLDTSELSFDAVVKQTLKEA 211
gi 2497488 147 RRAQDLGIAYdS-DKAFQELVAEIKHRDAVDTSRTADPLVQAPDAIYIDSSNLTFQQVVELMVQQA 211
gi 9910742 153 RRYKQR--NG-N-E-TLEELERTLKRRDDVDKKKQYGKLKLSKGVFYLDTSYKGLDDVCNIIIEKF 213
gi 1574494 195 RRYKQLQNKG-I-NGNFAQILAEIKERDFRDRNREVAPLKPADDAFYYSLNSS----IISCAFFTI 254
gi 585351  156 RRYEENVKKG-F-DVNYETLIEEIARRDKLDSEREVSPLRKAEDALEIDTTSLSIQEVADKILEAV 219
gi 1174254 160 RRLKDFEAQG-NqAVDLAQLEADIAHRDHLDSTRAIAPLQKAVDAVEIITDNLTIAEVVETIIELY 224
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap