1JOP


Conserved Protein Domain Family
TIGR00022

?
TIGR00022: TIGR00022 
Click on image for an interactive view with Cn3D
YhcH/YjgK/YiaL family protein
This family consists of conserved hypothetical proteins, about 150 amino acids in length. Members with limited information include YhcH, a possible sugar isomerase of sialic acid catabolism, and YjgK. [Unknown function, General]
Statistics
?
PSSM-Id: 129133
View PSSM: TIGR00022
Aligned: 6 rows
Threshold Bit Score: 205.774
Threshold Setting Gi: 15901526
Created: 7-Oct-2014
Updated: 23-Jan-2015
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
1JOP_A         1 MIISSLTNPNFKvGLPKVIAEVCDYLNTLDLNALENGRHDIN-DQIYMNVMEPETAEPSSKKAELHHEYLDVQVLIRGTE 79
gi 1176196     1 MMMGEVQSLPSA-GLHPALQDALTLALAARPQEKAPGRYELQgDNIFMNVMTFNTQSPVEKKAELHEQYIDIQLLLNGEE 79
gi 586715      1 MIFGHIAQPNPCr-LPAAIEKALDFLRATDFNALEPGVVEIDgKNIYTQIIDLTTREAVVNRPEVHRRYIDIQFLAWGEE 79
gi 1176197     1 MIISSLTNPNFKvGLPKVIAEVCDYLNTLDLNALENGRHDIN-DQIYMNVMEPETAEPSSKKAELHHEYLDVQVLIRGTE 79
gi 446509952   1 MIITKISRLGTYvGVNPHFATLIDFLEKTGLENLTEGSIAIDgNRLFGNCFTYLADGQAGAFFETHQKYLDIHLVLENEE 80
gi 446336027   4 MIIGNIHNLQPW--LPQELRQAIEHIKAHVTAETPKGKHDIEgNRLFYLISEDMTEPYEARRAEYHARYLDIQIVLKGQE 81
                         90       100       110       120       130       140
                 ....*....|....*....|....*....|....*....|....*....|....*....|...
1JOP_A        80 NIEVGATYPNLSKyEDYNEADDYQLCADIDDKFTVTMKPKMFAVFYPYEPHKPCCVVNG-KTE 141
gi 1176196    80 RILFGMAGTARQC-EEFHHEDDYQLCSTIDNEQAIILKPGMFAVFMPGEPHKPGCVVGE-PGE 140
gi 586715     80 KIGIAIDTGNNKVsESLLEQRNIIFYHDSEHESFIEMIPGSYAIFFPQDVHRPGCIMQT-ASE 141
gi 1176197    80 NIEVGATYPNLSKyEDYNEADDYQLCADIDDKFTVTMKPKMFAVFYPYEPHKPCCVVNGkTEK 142
gi 446509952  81 AMAV-TSPENVSVtQEYDEEKDIELY-TGKVEQLVHLRAGECLITFPEDLHQPKVRIND--EP 139
gi 446336027  82 GMTFSTQPAGAPD-TDWLADKDIAFLPEGVDEKTVILNEGDFVVFYPGEVHKPLCAVGA-PAQ 142
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap